商品一覧

法令ブランドカタログ番号商品名サイズ価格保存温度ＣＡＳ

　 AST AST-287-10mg A23187 【Calcium Ionophore】 10mg ￥27,300 RT 52665-69-7
　
　
A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho

　 AST AST-287-50mg A23187 【Calcium Ionophore】 50mg ￥70,500 RT 52665-69-7
　
　
A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho

劇物 AST AST-335-10mg A 769662 【6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile】 10mg ￥28,500 RT 844499-71-4
　
　
Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 μM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by

劇物 AST AST-335-50mg A 769662 【6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile】 50mg ￥74,700 RT 844499-71-4
　
　
Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 μM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by

　 AST AST-282-10mg A 803467 【5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide】 10mg ￥25,800 RT 944261-79-4
　
　
Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 μM). Shows no significant a

　 AST AST-282-50mg A 803467 【5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide】 50mg ￥62,700 RT 944261-79-4
　
　
Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 μM). Shows no significant a

　 AST AST-251-5mg ACEA 【(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide】 5mg ￥21,900 -20℃ 220556-69-4
　
　
Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.

　 AST AST-251-25mg ACEA 【(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide】【Potent, selective CB1 agonist】 25mg ￥42,000 -20℃ 220556-69-4
　
　
Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.

　 AST AST-096-5mg ACEA 【(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide】 in Ethanol Solution 5mg ￥21,900 -20℃ 220556-69-4
　
　
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.

　 AST AST-096-25mg ACEA 【(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide】【Potent, selective CB1 agonist】 in Ethanol Solution 25mg ￥42,000 -20℃ 220556-69-4
　
　
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.

　 AST AST-096-100mg ACEA 【(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide】【Potent, selective CB1 agonist】 100mg ￥109,800 -20℃ 220556-69-4
　
　
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.

　 AST AST-097-10mg ACPA 【(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide】【CB1 Agonist】 10mg ￥25,200 -20℃ 229021-64-1
　
　
Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.

　 AST AST-097-50mg ACPA 【(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide】【CB1 Agonist】 50mg ￥55,500 -20℃ 229021-64-1
　
　
Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.

　 AST AST-150-10mg 6,7-ADTN, HBr 【6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr】【Dopamine Agonist】 10mg ￥21,300 +4℃ 13575-86-5
　
　
Dopamine D1 agonist

　 AST AST-150-50mg 6,7-ADTN, HBr 【6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr】【Dopamine Agonist】 50mg ￥42,300 +4℃ 13575-86-5
　
　
Dopamine D1 agonist

　 AST AST-152-10mg AF-DX 116 【11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one】【M2 Antagonist】 10mg ￥28,800 RT 102394-31-0
　
　
Selective M2 receptor antagonist.

　 AST AST-152-50mg AF-DX 116 【11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one】【M2 Antagonist】 50mg ￥69,300 RT 102394-31-0
　
　
Selective M2 receptor antagonist.

　 AST AST-088-10mg AM 251 【1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide】 10mg ￥28,800 +4℃ 183232-66-8
　
　
Cannabinoid CB1 receptor antagonist / inverse agonist

　 AST AST-088-50mg AM 251 【1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide】 50mg ￥73,200 +4℃ 183232-66-8
　
　
Cannabinoid CB1 receptor antagonist / inverse agonist

　 AST AST-095-10mg AM 404 【(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide】【AnandamideTransport Inhibitor】 10mg ￥22,500 -20℃ 198022-70-7
　
　
Competitive and selective anandamide transport inhibitor (IC50 = 1 μM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep

　 AST AST-095-50mg AM 404 【(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide】【AnandamideTransport Inhibitor】 50mg ￥43,200 -20℃ 198022-70-7
　
　
Competitive and selective anandamide transport inhibitor (IC50 = 1 μM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep

　 AST AST-281-100mg Amiloride 100mg ￥19,500 RT 2016-88-8
　
　
Epithelial sodium channel (eNaC) blocker. At higher concentrations, blocks the Na+/H+ exchange pathway. Also blocks transient reception potential cation (TRPC6 and TRPP3) channels.

　 AST AST-123-100mg Aminoguanidine, HCl 【NOS Inhibitor】 100mg ￥21,000 RT 1937-19-5
　
　
Irreversible inhibitor of iNOS, displaying 26-fold selectivity over nNOS. In vitro and in vivo inhibitor of the formation of glycosylation end products associated with diabetes and aging.

　 AST AST-122-100mg 4-Aminopyridine 【K+ Channel Blocker】 100mg ￥18,300 RT 504-24-5
　
　
Potassium channel blocker. Blocks Kv channels. Convulsant, and useful tool to model epileptiform activity in vitro.

　 AST AST-011-10mg AMN082, 2HCl 【N,N'-Dibenzhydrylethane-1,2-diamine, 2HCl】 10mg ￥24,300 +4℃ 03027-13-8
　
　
Potent, selective, orally active and brain penetrant mGlu7 receptor agonist

　 AST AST-011-50mg AMN082, 2HCl 【N,N'-Dibenzhydrylethane-1,2-diamine, 2HCl】 50mg ￥51,300 +4℃ 03027-13-8
　
　
Potent, selective, orally active and brain penetrant mGlu7 receptor agonist

　 AST AST-130-10mg (RS)-AMPA 【(RS)-α-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid】【AMPA Agonist】 10mg ￥30,300 RT 74341-63-2
　
　
Prototypic agonist for AMPA receptors.

　 AST AST-130-50mg (RS)-AMPA 【(RS)-α-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid】【AMPA Agonist】 50mg ￥83,400 RT 74341-63-2
　
　
Prototypic agonist for AMPA receptors.

　 AST AST-005-5mg (S)-AMPA 【(S)-α-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid】【AMPA Agonist】 5mg ￥27,000 +4℃ 83643-88-3
　
　
AMPA agonist

　 AST AST-005-10mg (S)-AMPA 【(S)-α-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid】【AMPA Agonist】 10mg ￥33,900 +4℃ 83643-88-3
　
　
AMPA agonist

　 AST AST-005-50mg (S)-AMPA 【(S)-α-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid】【AMPA Agonist】 50mg ￥98,700 +4℃ 83643-88-3
　
　
AMPA agonist

　 AST AST-301-100ug Amyloid β (1-42) (human) 100ug ￥30,000 -20℃ 107761-42-2
　
　
42-residue amyloid β-protein fragment; the predominant form of amyloid β found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac

　 AST AST-301-1mg Amyloid β (1-42) (human) 1mg ￥81,300 -20℃ 107761-42-2
　
　
42-residue amyloid β-protein fragment; the predominant form of amyloid β found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac

　 AST AST-087-5mg Anandamide 【(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide】【Endogenous Cannabinoid】 5mg ￥21,300 -20℃ 94421-68-8
　
　
Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.

　 AST AST-087-25mg Anandamide 【(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide】【Endogenous Cannabinoid】 25mg ￥39,300 -20℃ 94421-68-8
　
　
Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.

　 AST AST-013-1mg (+/-)-Anatoxin A Fumarate 【(+/-)-2-Acetyl-9-azabicyclo[4.2.1]non-2-ene Fumarate】 1mg ￥29,100 +4℃ 64285-06-9
　
　
Potent nicotinic agonist

　 AST AST-183-5mg Angiotensin II 【Vasoconstrictor Peptide】 (human) 5mg ￥21,600 -20℃ 68521-88-0
　
　
Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino

　 AST AST-183-10mg Angiotensin II 【Vasoconstrictor Peptide】 (human) 10mg ￥40,800 -20℃ 68521-88-0
　
　
Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino

　 AST AST-316-50mg Aniracetam 【1-(4-Anisoyl)pyrrolidin-2-one】 50mg ￥23,400 RT 72432-10-1
　
　
Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.

　 AST AST-316-250mg Aniracetam 【1-(4-Anisoyl)pyrrolidin-2-one】 250mg ￥41,400 RT 72432-10-1
　
　
Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.

　 AST AST-001-100mg DL-AP4 【DL-2-Amino-4-phosphonobutyric Acid】【NMDA receptor Antagonist】 100mg ￥24,900 +4℃ 20263-07-4
　
　
Selective group III mGlu receptor agonist

　 AST AST-001-1g DL-AP4 【DL-2-Amino-4-phosphonobutyric Acid】【NMDA receptor Antagonist】 1g ￥76,500 +4℃ 20263-07-4
　
　
Selective group III mGlu receptor agonist

　 AST AST-002-10mg L-AP4 【L-2-Amino-4-phosphonobutyric Acid】【Selective group III mGlu Agonist】 10mg ￥29,400 +4℃ 23052-81-5
　
　
Competitive NMDA receptor glutamate site antagonist

　 AST AST-002-50mg L-AP4 【L-2-Amino-4-phosphonobutyric Acid】【Selective group III mGlu Agonist】 50mg ￥79,800 +4℃ 23052-81-5
　
　
Competitive NMDA receptor glutamate site antagonist

　 AST AST-253-100mg L-AP4 【L-2-Amino-4-phosphonobutyric Acid】【Selective group III mGlu Agonist】, Na salt 100mg ￥22,500 RT none
　
　
Broad spectrum receptor antagonist - water soluble form.

　 AST AST-271-10mg DL-AP5 【DL-2-Amino-5-phosphonopentanoic Acid】, Na salt 10mg ￥21,600 +4℃ none
　
　
Competitive NMDA receptor glutamate site antagonist. Water soluble form.

　 AST AST-271-50mg DL-AP5 【DL-2-Amino-5-phosphonopentanoic Acid】, Na salt 50mg ￥42,000 +4℃ none
　
　
Competitive NMDA receptor glutamate site antagonist. Water soluble form.

　 AST AST-003-10mg D-AP5 【D-2-Amino-5-phosphonopentanoic Acid】【NMDA Glutamate site Antagonist】 10mg ￥27,900 +4℃ 79055-68-8
　
　
Competitive NMDA receptor glutamate site antagonist

　 AST AST-003-50mg D-AP5 【D-2-Amino-5-phosphonopentanoic Acid】【NMDA Glutamate site Antagonist】 50mg ￥72,900 +4℃ 79055-68-8
　
　
Competitive NMDA receptor glutamate site antagonist

　 AST AST-003-100mg D-AP5 【D-2-Amino-5-phosphonopentanoic Acid】【NMDA Glutamate site Antagonist】 100mg ￥91,200 +4℃ 79055-68-8
　
　
Competitive NMDA receptor glutamate site antagonist

　 AST AST-268-500ug Apamin 500ug ￥36,300 -20℃ 24345-16-2
　
　
Peptide neurotoxin that naturally occurs in Apis mellifera bee venom. Blocks small conductance Ca2+ activated K+ channels (SK). Selective for KCa2.1-2.3 (SK1-3) isoforms. Blocks hSK1, rSK2 and liver r

　 AST AST-124-100mg 2-APB 【2-Aminoethyl Diphenyl Borinate】【Ca2+ Release Modulator】 100mg ￥20,100 +4℃ 524-95-8
　
　
Cell permeable, allosteric inhibitor of D-myo-inositol 1,4,5-trisphosphate (IP3) -induced Ca2+ release . Inhibits IP3-induced Cat2+ release without affecting IP3 receptor binding. Blocks store operate

　 AST AST-141-10mg Apigenin 【4,5,7-Trihydroxyflavone】 10mg ￥18,300 +4℃ 520-36-5
　
　
Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-κB.

　 AST AST-141-50mg Apigenin 【4,5,7-Trihydroxyflavone】 50mg ￥28,500 +4℃ 520-36-5
　
　
Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-κB.

　 AST AST-151-10mg AQ-RA 741 【11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one】【M2 Antagonist】 10mg ￥27,900 RT 123548-16-3
　
　
Potent, selective M2 receptor antagonist.

　 AST AST-151-50mg AQ-RA 741 【11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one】【M2 Antagonist】 50mg ￥67,500 RT 123548-16-3
　
　
Potent, selective M2 receptor antagonist.

劇物 AST AST-098-5mg 2-Arachidonoylglycerol in Acetontrile 5mg ￥28,500 -20℃ 53847-30-6
　
　
Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.

劇物 AST AST-098-25mg 2-Arachidonoylglycerol in Acetontrile 25mg ￥58,500 -20℃ 53847-30-6
　
　
Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.

　 AST AST-004-10mg DL-ASP5 【DL-(-)-2-Amino-5-phosphonopentanoic Acid】【NMDA Glutamate site Antagonist】 10mg ￥21,000 +4℃ 76326-31-3
　
　
Competitive NMDA receptor glutamate site antagonist.

　 AST AST-004-50mg DL-ASP5 【DL-(-)-2-Amino-5-phosphonopentanoic Acid】【NMDA Glutamate site Antagonist】 50mg ￥38,700 +4℃ 76326-31-3
　
　
Competitive NMDA receptor glutamate site antagonist.

　 AST AST-179-1mg AY-NH2 【PAR4 Agonist Peptide】 1mg ￥27,300 -20℃ 352017-71-1
　
　
Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2

　 AST AST-179-5mg AY-NH2 【PAR4 Agonist Peptide】 5mg ￥64,800 -20℃ 352017-71-1
　
　
Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2

　 AST AST-149-1g (RS)-Baclofen 【(R,S)-4-Amino-3-(4-chlorophenyl)butanoic Acid】【GABAB Agonist】 1g ￥20,700 RT 1134-47-0
　
　
Selective GABAB receptor agonist. Antispasmodic.

　 AST AST-178-1mg BAM (8-22) 【SNSR Agonist】 1mg ￥40,500 -20℃ 412961-36-5
　
　
Endogenous peptide fragment that is a selective agonist for the sensory neuron specific receptor (EC50 values are 28 and 14 nM for SNSR3 and SNSR4 respectively). Inhibits development of morphine toler

　 AST AST-107-50mg (+)-Bicuculline 【(S)-6-((S)-5,6,7,8-Tetrahydro-6-methyl-[1,3]dioxolo[4,5-g]isoquinolin-5-yl)isobenzofuro[4,5-d][1,3]dioxol-8(6H)-one】【GABAA Antagonist.】 50mg ￥30,300 +4℃ 485-49-4
　
　
GABAA antagonist.

　 AST AST-108-10mg (-)-Bicuculline Methiodide 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide】【GABAA Antagonist】 10mg ￥23,700 +4℃ 55950-07-7
　
　
Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-108-50mg (-)-Bicuculline Methiodide 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide】【GABAA Antagonist】 50mg ￥50,400 +4℃ 55950-07-7
　
　
Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-109-10mg (-)-Bicuculline Methobromide 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide】【GABAA Antagonist】 10mg ￥24,600 +4℃ 73604-30-5
　
　
Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-109-50mg (-)-Bicuculline Methobromide 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide】【GABAA Antagonist】 50mg ￥56,700 +4℃ 73604-30-5
　
　
Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-110-10mg (-)-Bicuculline Methochloride 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride】【GABAA Antagonist】 10mg ￥24,300 +4℃ 53552-05-9
　
　
Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-110-50mg (-)-Bicuculline Methochloride 【[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride】【GABAA Antagonist】 50mg ￥52,500 +4℃ 53552-05-9
　
　
Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.

　 AST AST-299-5mg Brefeldin A 5mg ￥27,000 -20℃ 20350-15-6
　
　
Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, β-COP and ADP-ribosylation factor (ARF) to Golgi m

　 AST AST-299-25mg Brefeldin A 25mg ￥57,000 -20℃ 20350-15-6
　
　
Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, β-COP and ADP-ribosylation factor (ARF) to Golgi m

　 AST AST-240-1g Caffeine 【1,3,7-Trimethylxanthine】【PDE Inhibitor】【Adenosine Antagonist】 1g ￥17,100 RT 58-08-2
　
　
Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.

　 AST AST-240-5g Caffeine 【1,3,7-Trimethylxanthine】【PDE Inhibitor】【Adenosine Antagonist】 5g ￥18,300 RT 58-08-2
　
　
Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.

　 AST AST-115-50mg Camptothecin 【(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione】【DNA Topoisomerase Inhibitor】 50mg ￥20,700 +4℃ 7689-03-4
　
　
Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.

　 AST AST-115-250mg Camptothecin 【(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione】【DNA Topoisomerase Inhibitor】 250mg ￥38,400 +4℃ 7689-03-4
　
　
Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.

　 AST AST-025-10mg Capsazepine 【VR1 Vanilloid Receptor Antagonist】 10mg ￥27,300 +4℃ 138977-28-3
　
　
VR1 vanilloid receptor antagonist

　 AST AST-025-50mg Capsazepine 【VR1 Vanilloid Receptor Antagonist】 50mg ￥70,800 +4℃ 138977-28-3
　
　
VR1 vanilloid receptor antagonist

　 AST AST-209-1mg CCK Octapeptide Sulfated 1mg ￥34,500 -20℃ 25126-32-3
　
　
Endogenous C-terminal octapeptide of CCK involved in the neurobiology of anxiety, depression, psychosis, cognition, nociception and feeding behavior.

　 AST AST-012-10mg CGP 37157 【7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one】【Na+-Ca2+ Exchange Inhibitor】 10mg ￥28,500 +4℃ none
　
　
Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger

　 AST AST-012-50mg CGP 37157 【7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one】【Na+-Ca2+ Exchange Inhibitor】 50mg ￥75,300 +4℃ none
　
　
Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger

　 AST AST-127-10mg CGP 37849 【(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid】【Competitive NMDA Antagonist】 10mg ￥31,200 +4℃ 127910-31-0
　
　
Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.

　 AST AST-127-50mg CGP 37849 【(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid】【Competitive NMDA Antagonist】 50mg ￥86,100 +4℃ 127910-31-0
　
　
Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.

　 AST AST-128-10mg CGP 39551 【(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid】【Competitive NMDA Antagonist】 10mg ￥28,500 +4℃ 127910-32-1
　
　
Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.

　 AST AST-128-50mg CGP 39551 【(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid】【Competitive NMDA Antagonist】 50mg ￥72,600 +4℃ 127910-32-1
　
　
Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.

　 AST AST-269-10ug Charybdotoxin 10ug ￥22,800 -20℃ 95751-30-7
　
　
Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC

　 AST AST-269-100ug Charybdotoxin 100ug ￥50,400 -20℃ 95751-30-7
　
　
Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC

　 AST AST-037-10mg 2-Chloroadenosine 【Adenosine Agonist】 10mg ￥21,300 +4℃ 146-77-0
　
　
Adenosine receptor agonist

　 AST AST-037-50mg 2-Chloroadenosine 【Adenosine Agonist】 50mg ￥26,100 +4℃ 146-77-0
　
　
Adenosine receptor agonist

　 AST AST-037-250mg 2-Chloroadenosine 【Adenosine Agonist】 250mg ￥64,500 +4℃ 146-77-0
　
　
Adenosine receptor agonist

　 AST AST-024-10mg 7-Chlorokynurenic Acid 【7-Chloro-4-hydroxyquinoline-2-carboxylic Acid】【NMDA Receptor Glycine site Antagonist】 10mg ￥22,200 +4℃ 18000-24-3
　
　
Potent NMDA receptor glycine site antagonist

　 AST AST-024-50mg 7-Chlorokynurenic Acid 【7-Chloro-4-hydroxyquinoline-2-carboxylic Acid】【NMDA Receptor Glycine site Antagonist】 50mg ￥36,000 +4℃ 18000-24-3
　
　
Potent NMDA receptor glycine site antagonist

　 AST AST-255-10mg 7-Chlorokynurenic Acid 【7-Chloro-4-hydroxyquinoline-2-carboxylic Acid】【NMDA Receptor Glycine site Antagonist】, Na salt 10mg ￥23,100 RT none
　
　
Potent NMDA receptor glycine site antagonist. Water soluble form.

　 AST AST-255-50mg 7-Chlorokynurenic Acid 【7-Chloro-4-hydroxyquinoline-2-carboxylic Acid】【NMDA Receptor Glycine site Antagonist】, Na salt 50mg ￥38,700 RT none
　
　
Potent NMDA receptor glycine site antagonist. Water soluble form.

　 AST AST-039-10mg (RS)-CHPG 【(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid】【Selective mGlu5 Agonist】 10mg ￥23,400 +4℃ none
　
　
Selective mGlu5 receptor agonist

　 AST AST-039-50mg (RS)-CHPG 【(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid】【Selective mGlu5 Agonist】 50mg ￥50,100 +4℃ none
　
　
Selective mGlu5 receptor agonist

　 AST AST-221-10mg (RS)-CHPG, Na salt 【(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Ａcid, Na salt】【mGlu5 Agonist】 10mg ￥24,900 +4℃ none
　
　
Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist

　 AST AST-221-50mg (RS)-CHPG, Na salt 【(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Ａcid, Na salt】【mGlu5 Agonist】 50mg ￥54,600 +4℃ none
　
　
Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist

劇物 AST AST-133-25mg Citalopram 【1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr】【5HT Reuptake Inhibitor】 25mg ￥31,800 RT 59729-32-7
　
　
Selective serotonin reuptake inhibitor. Antidepressant in vivo.

劇物 AST AST-133-100mg Citalopram 【1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr】【5HT Reuptake Inhibitor】 100mg ￥74,400 RT 59729-32-7
　
　
Selective serotonin reuptake inhibitor. Antidepressant in vivo.

　 AST AST-019-50mg Clozapine 【(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine】 50mg ￥25,500 +4℃ 5786-21-0
　
　
A typical antipsychotic compound.

　 AST AST-019-500mg Clozapine 【(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine】 500mg ￥70,800 +4℃ 5786-21-0
　
　
A typical antipsychotic compound.

劇物 AST AST-017-10mg CNQX 【6-Cyano-7-nitroquinoxaline-2,3-dione】 10mg ￥26,400 +4℃ 115066-14-3
　
　
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.

劇物 AST AST-017-25mg CNQX 【6-Cyano-7-nitroquinoxaline-2,3-dione】 25mg ￥41,700 +4℃ 115066-14-3
　
　
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.

劇物 AST AST-017-50mg CNQX 【6-Cyano-7-nitroquinoxaline-2,3-dione】 50mg ￥64,500 +4℃ 115066-14-3
　
　
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.

劇物 AST AST-044-10mg CNQX, 2Na salt 【6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt】 10mg ￥25,800 +4℃ none
　
　
Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.

劇物 AST AST-044-50mg CNQX, 2Na salt 【6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt】 50mg ￥62,100 +4℃ none
　
　
Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.

　 AST AST-060-10mg CPCCOEt 【(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate】 10mg ￥27,900 +4℃ 179067-99-3
　
　
Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist

　 AST AST-060-50mg CPCCOEt 【(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate】 50mg ￥68,100 +4℃ 179067-99-3
　
　
Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist

　 AST AST-159-10mg (R)-CPP 【(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid】 10mg ￥42,300 RT 126453-07-4
　
　
Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 μM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.

　 AST AST-159-50mg (R)-CPP 【(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid】 50mg ￥139,500 RT 126453-07-4
　
　
Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 μM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.

劇物 AST AST-093-100mg Cycloheximide 【3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide】【Protein Synthesis Inhibitor】 100mg ￥18,300 +4℃ 66-81-9
　
　
Protein synthesis inhibitor. Antifungal antibiotic.

劇物 AST AST-093-1g Cycloheximide 【3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide】【Protein Synthesis Inhibitor】 1g ￥27,000 +4℃ 66-81-9
　
　
Protein synthesis inhibitor. Antifungal antibiotic.

　 AST AST-300-10mg Cyclopiazonic Acid from Penicillium grisefulvum 10mg ￥25,500 -20℃ 18172-33-3
　
　
Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.

　 AST AST-300-50mg Cyclopiazonic Acid from Penicillium grisefulvum 50mg ￥58,500 -20℃ 18172-33-3
　
　
Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.

　 AST AST-121-50mg D-Cycloserine 【(R)-4-Aminoisoxazolidin-3-one】【NMDA Glycine site Agonist】 50mg ￥18,300 -20℃ 68-41-7
　
　
Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.

　 AST AST-121-250mg D-Cycloserine 【(R)-4-Aminoisoxazolidin-3-one】【NMDA Glycine site Agonist】 250mg ￥28,500 -20℃ 68-41-7
　
　
Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.

　 AST AST-114-25mg Cyclosporin A 【PP2B Inhibitor】 25mg ￥20,100 -20℃ 59865-13-3
　
　
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).

　 AST AST-114-100mg Cyclosporin A 【PP2B Inhibitor】 100mg ￥23,400 -20℃ 59865-13-3
　
　
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).

　 AST AST-114-250mg Cyclosporin A 【PP2B Inhibitor】 250mg ￥51,900 -20℃ 59865-13-3
　
　
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).

　 AST AST-061-10mg Cyclothiazide 【6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide】 10mg ￥22,200 +4℃ 2259-96-3
　
　
Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.

　 AST AST-061-50mg Cyclothiazide 【6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide】 50mg ￥43,200 +4℃ 2259-96-3
　
　
Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.

　 AST AST-220-10mg D4476 【4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide】【CK1 Inhibitor】 10mg ￥31,200 +4℃ 301836-43-1
　
　
Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 μM for CK1, ALK5, PKD1 and p38αMAPK respectively. Displays selectivity over many other protein kin

　 AST AST-220-50mg D4476 【4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide】【CK1 Inhibitor】 50mg ￥87,600 +4℃ 301836-43-1
　
　
Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 μM for CK1, ALK5, PKD1 and p38αMAPK respectively. Displays selectivity over many other protein kin

　 AST AST-144-25mg 4-DAMP 【4-Diphenylacetoxy-N-methylpiperidine Methiodide】【Muscarinic Receptor Antagonist】 25mg ￥21,900 RT 1952-15-4
　
　
Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.

　 AST AST-144-100mg 4-DAMP 【4-Diphenylacetoxy-N-methylpiperidine Methiodide】【Muscarinic Receptor Antagonist】 100mg ￥38,700 RT 1952-15-4
　
　
Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.

　 AST AST-006-10mg (S)-3,4-DCPG 【UBP1109】【(S)-3,4-Dicarboxyphenylglycine】 10mg ￥32,100 +4℃ none
　
　
Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.

　 AST AST-006-50mg (S)-3,4-DCPG 【UBP1109】【(S)-3,4-Dicarboxyphenylglycine】 50mg ￥88,500 +4℃ none
　
　
Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.

　 AST AST-026-10mg N-Desmethylclozapine 【Normethylclozapine】【8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine】 10mg ￥27,300 +4℃ 6104-71-8
　
　
Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist

　 AST AST-026-50mg N-Desmethylclozapine 【Normethylclozapine】【8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine】 50mg ￥67,500 +4℃ 6104-71-8
　
　
Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist

　 AST AST-016-10mg Desmethyl YM298198 【6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide】 10mg ￥30,300 +4℃ none
　
　
Derivative of mGlu1 antagonist YM298198 (#Asc-015)

　 AST AST-016-50mg Desmethyl YM298198 【6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide】 50mg ￥84,300 +4℃ none
　
　
Derivative of mGlu1 antagonist YM298198 (#Asc-015)

　 AST AST--307-50mg γ-DGG 【(R)-4-(Carboxymethylcarbamoyl)-2-aminobutanoic Acid】 50mg ￥25,500 +4℃ 6729-55-1
　
　
Ionotropic glutamate receptor antagonist that has been used as a rapidly dissociating, low affinity competitive antagonist at AMPA receptors.

　 AST AST-020-10mg (R,S)-3,5-DHPG 【2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid】 10mg ￥27,000 +4℃ 19641-83-9
　
　
Selective group I mGlu receptor agonist

　 AST AST-020-50mg (R,S)-3,5-DHPG 【2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid】 50mg ￥68,100 +4℃ 19641-83-9
　
　
Selective group I mGlu receptor agonist

　 AST AST-007-5mg (S)-3,5-DHPG 【(S)-3,5-Dihydroxyphenylglycine】 5mg ￥27,600 +4℃ 162870-29-3
　
　
Selective group I mGlu agonist.

　 AST AST-007-10mg (S)-3,5-DHPG 【(S)-3,5-Dihydroxyphenylglycine】 10mg ￥37,500 +4℃ 162870-29-3
　
　
Selective group I mGlu agonist.

　 AST AST-266-100mg Diazoxide 【7-Chloro-3-methyl-2H-1,2,4-benzothiadiazine 1,1-Dioxide】 100mg ￥19,500 RT 364-98-7
　
　
Selective KIR6.x (ATP-sensitive K+ channel) activator; antihypertensive.

　 AST AST-023-10mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】 10mg ￥22,200 +4℃ 131123-76-7
　
　
Potent NMDA receptor glycine site antagonist.

　 AST AST-023-50mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】 50mg ￥44,700 +4℃ 131123-76-7
　
　
Potent NMDA receptor glycine site antagonist.

　 AST AST-023-100mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】 100mg ￥52,200 +4℃ 131123-76-7
　
　
Potent NMDA receptor glycine site antagonist.

　 AST AST-254-10mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】, Na salt 10mg ￥23,100 RT none
　
　
Potent NMDA receptor glycine site antagonist. Water soluble form.

　 AST AST-254-50mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】, Na salt 50mg ￥48,900 RT none
　
　
Potent NMDA receptor glycine site antagonist. Water soluble form.

　 AST AST-254-100mg 5,7-Dichlorokynurenic Acid 【5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid】, Na salt 100mg ￥57,000 RT none
　
　
Potent NMDA receptor glycine site antagonist. Water soluble form.

　 AST AST-066-10mg Dihydrokainic Acid 【Dihydrokainate】【(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid】 10mg ￥29,700 +4℃ 52497-36-6
　
　
Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 μM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).

　 AST AST-066-50mg Dihydrokainic Acid 【Dihydrokainate】【(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid】 50mg ￥78,000 +4℃ 52497-36-6
　
　
Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 μM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).

　 AST AST-260-1g Diltiazem 1g ￥21,600 RT 33286-22-5
　
　
L-type Ca2+ channel antagonist. Coronary vasodilator.

　 AST AST-018-10mg DNQX 【6,7-Dinitroquinoxaline-2,3-dione】 10mg ￥18,600 +4℃ 2379-57-9
　
　
AMPA / Kainate antagonist

　 AST AST-018-50mg DNQX 【6,7-Dinitroquinoxaline-2,3-dione】 50mg ￥26,700 +4℃ 2379-57-9
　
　
AMPA / Kainate antagonist

　 AST AST-169-10mg DNQX, 2Na salt 【6,7-Dinitroquinoxaline-2,3-dione, 2Na salt】【AMPA / Kainate Antagonist】 10mg ￥20,700 +4℃ 2379-57-9
　
　
Water soluble, AMPA / kainate antagonist

　 AST AST-169-50mg DNQX, 2Na salt 【6,7-Dinitroquinoxaline-2,3-dione, 2Na salt】【AMPA / Kainate Antagonist】 50mg ￥37,200 +4℃ 2379-57-9
　
　
Water soluble, AMPA / kainate antagonist

劇物 AST AST-166-10mg DPN 【2,3-Bis(4-hydroxyphenyl)propionitrile】【Potent, selective ERβ Agonist】 10mg ￥26,400 -20℃ 1428-67-7
　
　
Potent, selective ERβ agonist (EC50 values are 0.85 and 66 nM for ERβ and ERα respectively). Cardioprotective and neuroprotective in vivo.

劇物 AST AST-166-50mg DPN 【2,3-Bis(4-hydroxyphenyl)propionitrile】【Potent, selective ERβ Agonist】 50mg ￥65,100 -20℃ 1428-67-7
　
　
Potent, selective ERβ agonist (EC50 values are 0.85 and 66 nM for ERβ and ERα respectively). Cardioprotective and neuroprotective in vivo.

　 AST AST-192-10mg Dynasore 【3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate】【Cell permeable Dynamin Inhibitor】 10mg ￥25,200 -20℃ 304448-55-3
　
　
Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.

　 AST AST-192-50mg Dynasore 【3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate】【Cell permeable Dynamin Inhibitor】 50mg ￥59,100 -20℃ 304448-55-3
　
　
Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.

　 AST AST-258-10mg 1-EBIO 【1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one】 10mg ￥21,300 RT 10045-45-1
　
　
Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.

　 AST AST-258-50mg 1-EBIO 【1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one】 50mg ￥42,600 RT 10045-45-1
　
　
Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.

　 AST AST-158-10mg E-4031, 2HCl 【N-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide】【HERG K+ Channel Blocker】 10mg ￥28,800 +4℃ 113559-13-0
　
　
Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl

　 AST AST-158-50mg E-4031, 2HCl 【N-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide】【HERG K+ Channel Blocker】 50mg ￥76,200 +4℃ 113559-13-0
　
　
Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl

　 AST AST-328-10mg EMD 386088, HCl 【5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl】 10mg ￥25,500 RT 54635-62-0
　
　
Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D

　 AST AST-328-50mg EMD 386088, HCl 【5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl】 50mg ￥60,000 RT 54635-62-0
　
　
Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D

　 AST AST-311-10mg Etomidate 【Ethyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate】 10mg ￥26,100 RT 33125-97-2
　
　
Agonist at GABAA receptors containing β3 subunits. Anaesthetic and amnesic properties.

　 AST AST-311-50mg Etomidate 【Ethyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate】 50mg ￥64,500 RT 33125-97-2
　
　
Agonist at GABAA receptors containing β3 subunits. Anaesthetic and amnesic properties.

　 AST AST-227-25mg Etoposide 【Topoisomerase II Inhibitor】 25mg ￥20,700 RT 33419-42-0
　
　
Topoisomerase II inhibitor. Anticancer agent.

　 AST AST-227-100mg Etoposide 【Topoisomerase II Inhibitor】 100mg ￥26,400 RT 33419-42-0
　
　
Topoisomerase II inhibitor. Anticancer agent.

　 AST AST-214-0.5mg Exendin-4 0.5mg ￥33,000 -20℃ 141758-74-9
　
　
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

　 AST AST-214-1mg Exendin-4 1mg ￥45,000 -20℃ 141758-74-9
　
　
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

　 AST AST-292-10mg Exo-1 【Methyl 2-(4-Fluorobenzamido)benzoate】 10mg ￥24,000 RT 461681-88-9
　
　
Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 μM. Rapidly releases Arf1 from Golgi

　 AST AST-292-50mg Exo-1 【Methyl 2-(4-Fluorobenzamido)benzoate】 50mg ￥54,000 RT 461681-88-9
　
　
Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 μM. Rapidly releases Arf1 from Golgi

劇物 AST AST-081-10mg FCCP 【Carbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone】 10mg ￥24,000 +4℃ 370-86-5
　
　
A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.

劇物 AST AST-081-50mg FCCP 【Carbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone】 50mg ￥51,600 +4℃ 370-86-5
　
　
A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.

　 AST AST-034-10mg Fenobam 【1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea】 10mg ￥25,500 +4℃ 57653-26-6
　
　
Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie

　 AST AST-034-50mg Fenobam 【1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea】 50mg ￥61,500 +4℃ 57653-26-6
　
　
Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie

　 AST AST-223-10mg FK506 10mg ￥25,500 -20℃ 109581-93-3
　
　
Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.

　 AST AST-223-50mg FK506 50mg ￥60,000 -20℃ 109581-93-3
　
　
Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.

　 AST AST-242-10mg Flumazenil 【8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester】【Benzodiazepine Antagonist】 10mg ￥23,700 +4℃ 78755-81-4
　
　
Selective non-competitive benzodiazepine antagonist with low affinity for α4- and α6-subunits

　 AST AST-242-50mg Flumazenil 【8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester】【Benzodiazepine Antagonist】 50mg ￥52,200 +4℃ 78755-81-4
　
　
Selective non-competitive benzodiazepine antagonist with low affinity for α4- and α6-subunits

　 AST AST-036-10mg (S)-5-Fluorowillardiine 【S)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 10mg ￥30,900 +4℃ 140187-23-1
　
　
Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.

　 AST AST-036-50mg (S)-5-Fluorowillardiine 【S)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 50mg ￥81,000 +4℃ 140187-23-1
　
　
Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.

　 AST AST-077-10mg Fluoxetine, HCl 【N-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl】 10mg ￥22,200 +4℃ 56296-78-7
　
　
Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove

　 AST AST-077-50mg Fluoxetine, HCl 【N-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl】 50mg ￥44,100 +4℃ 56296-78-7
　
　
Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove

　 AST AST-058-10mg Forskolin 【(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate】 10mg ￥30,300 -20℃ 66575-29-9
　
　
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti

　 AST AST-058-50mg Forskolin 【(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate】 50mg ￥65,700 -20℃ 66575-29-9
　
　
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti

　 AST AST-058-100mg Forskolin 【(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate】 100mg ￥113,400 -20℃ 66575-29-9
　
　
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti

　 AST AST-219-10mg Gabapentin 【2-[1-(Aminomethyl)cyclohexyl]acetic Acid】【α2δ Ligand】 10mg ￥22,800 +4℃ 60142-96-3
　
　
Interacts with the α2δ subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.

　 AST AST-219-50mg Gabapentin 【2-[1-(Aminomethyl)cyclohexyl]acetic Acid】【α2δ Ligand】 50mg ￥45,900 +4℃ 60142-96-3
　
　
Interacts with the α2δ subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.

　 AST AST-172-0.5mg Galanin (1-16) (porcine, rat) 0.5mg ￥28,500 -20℃ none
　
　
N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI

　 AST AST-172-1mg Galanin (1-16) (porcine, rat) 1mg ￥37,500 -20℃ none
　
　
N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI

　 AST AST-112-10mg Genistein 【5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one】【Protein Tyrosine Kinase Inhibitor】【Anticancer Agent】 10mg ￥19,200 -20℃ 446-72-0
　
　
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.

　 AST AST-112-50mg Genistein 【5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one】【Protein Tyrosine Kinase Inhibitor】【Anticancer Agent】 50mg ￥31,200 -20℃ 446-72-0
　
　
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.

　 AST AST-112-100mg Genistein 【5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one】【Protein Tyrosine Kinase Inhibitor】【Anticancer Agent】 100mg ￥43,500 -20℃ 446-72-0
　
　
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.

　 AST AST-230-1mg Ghrelin (human) 1mg ￥64,200 -20℃ 258279-04-8
　
　
Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se

　 AST AST-231-1mg Ghrelin (rat) 1mg ￥64,200 -20℃ 258279-04-8
　
　
Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se

　 AST AST-267-100mg Glibenclamide 【N-p-[2-(5-Chloro-2-methoxybenzamido)ethyl]benzenesulfonyl-N'-cyclohexylurea】 100mg ￥18,900 RT 10238-21-8
　
　
Selective blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.

　 AST AST-049-1g L-Glutamate 【(S)-2-Aminopentanedioic Acid】 1g ￥17,400 +4℃ 56-86-0
　
　
Excitatory neurotransmitter.

　 AST AST-049-2.5g L-Glutamate 【(S)-2-Aminopentanedioic Acid】 2.5g ￥18,300 +4℃ 56-86-0
　
　
Excitatory neurotransmitter.

　 AST AST-050-100mg Glycine 【2-Aminoacetic Acid】 100mg ￥16,500 +4℃ 56-40-6
　
　
Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.

　 AST AST-050-1g Glycine 【2-Aminoacetic Acid】 1g ￥18,300 +4℃ 56-40-6
　
　
Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.

　 AST AST-125-50mg Granisetron 【1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl】【5HT3 Antagonist】 50mg ￥26,700 +4℃ 107007-99-8
　
　
Highly selective 5HT3 antagonist. Anti-emetic.

　 AST AST-125-250mg Granisetron 【1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl】【5HT3 Antagonist】 250mg ￥67,800 +4℃ 107007-99-8
　
　
Highly selective 5HT3 antagonist. Anti-emetic.

　 AST AST-306-10mg HA-1077 【1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl】 10mg ￥25,500 RT 103745-39-7
　
　
ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 μM, 4 μM and 5 μM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi

　 AST AST-306-50mg HA-1077 【1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl】 50mg ￥62,400 RT 103745-39-7
　
　
ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 μM, 4 μM and 5 μM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi

　 AST AST-080-100mg Haloperidol 【4-[4-(4-Chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one】 100mg ￥21,000 +4℃ 52-86-3
　
　
Dopamine antagonist with selectivity for D2-like receptors (Ki values are 1.2, 7, 2.3, 80 and 100 nM for D2, D3, D4, D1 and D5 receptors respectively). Also NMDA antagonist.

　 AST AST-225-100mg Harmine 【7-Methoxy-1-methyl-9H-pyrido[3,4-b]indole】 100mg ￥21,600 RT 442-51-3
　
　
Potent and selective inhibitor of DYRK1A (dual specificity tyrosine-phosphorylated and -regulated kinase). IC50 values are 0.08, 0.9, 0.8, 4.3 and 1.5 μM for DYRK1A, DYRK2, DYRK3, PIM3 and CK1 respec

　 AST AST-147-1mg Herkinorin 【Non-internalising μ Opioid Agonist】 1mg ￥28,500 +4℃ none
　
　
Selective μ opioid receptor agonist derived from the plant product, salvinorin A (Asc-084). Does not promote the recruitment of beta-arrestin-2 or lead to receptor internalization.

　 AST AST-041-1mg Ibotenic Acid 【2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid】 1mg ￥25,800 -20℃ 2552-55-8
　
　
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.

　 AST AST-041-5mg Ibotenic Acid 【2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid】 5mg ￥36,300 -20℃ 2552-55-8
　
　
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.

　 AST AST-041-25mg Ibotenic Acid 【2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid】 25mg ￥106,200 -20℃ 2552-55-8
　
　
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.

　 AST AST-131-10mg ICI 182,780 【(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol】【Estrogen receptor antagonist 10mg ￥24,300 RT 129453-61-8
　
　
Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.

　 AST AST-131-50mg ICI 182,780 【(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol】【Estrogen receptor antagonist 50mg ￥56,400 RT 129453-61-8
　
　
Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.

　 AST AST-111-10mg Ifenprodil 【4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate】【NR2B-preferring NMDA Antagonist】 10mg ￥20,700 +4℃ 23210-58-4
　
　
Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 μM at NR1/NR2B and >30 μM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors

　 AST AST-111-50mg Ifenprodil 【4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate】【NR2B-preferring NMDA Antagonist】 50mg ￥39,600 +4℃ 23210-58-4
　
　
Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 μM at NR1/NR2B and >30 μM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors

　 AST AST-222-10mg (S)-5-Iodowillardiine 【(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】【GluR5 Kainate Agonist】 10mg ￥29,400 RT 140187-25-3
　
　
Selective GluR5 Kainate receptor agonist (EC50 = 83 μM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.

　 AST AST-222-50mg (S)-5-Iodowillardiine 【(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】【GluR5 Kainate Agonist】 50mg ￥81,300 RT 140187-25-3
　
　
Selective GluR5 Kainate receptor agonist (EC50 = 83 μM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.

　 AST AST-116-1mg Ionomycin Ca2+ Salt 【Calcium Ionophore】 1mg ￥24,600 +4℃ 56092-82-1
　
　
Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.

　 AST AST-116-5mg Ionomycin Ca2+ Salt 【Calcium Ionophore】 5mg ￥58,800 +4℃ 56092-82-1
　
　
Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.

　 AST AST-142-10mg Isradipine 【4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester】【L-type Ca2+ Channel Blocker】 10mg ￥25,200 +4℃ 75695-93-1
　
　
L-type Ca2+ channel blocker.

　 AST AST-142-50mg Isradipine 【4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester】【L-type Ca2+ Channel Blocker】 50mg ￥60,600 +4℃ 75695-93-1
　
　
L-type Ca2+ channel blocker.

　 AST AST-191-10mg JNJ 10191584 Mmaleate 【(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate】【Selective H4 Antagonist】 10mg ￥27,000 RT 869497-75-6
　
　
Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.

　 AST AST-191-50mg JNJ 10191584 Mmaleate 【(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate】【Selective H4 Antagonist】 50mg ￥68,400 RT 869497-75-6
　
　
Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.

　 AST AST-100-10mg Kainic Acid 【(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid】 10mg ￥29,400 +4℃ 58002-62-3
　
　
Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.

　 AST AST-100-50mg Kainic Acid 【(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid】 50mg ￥74,700 +4℃ 58002-62-3
　
　
Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.

　 AST AST-284-10mg KB-R7943 【2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate】 10mg ￥27,300 RT 182004-65-5
　
　
Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 μM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 μM, 0

　 AST AST-284-50mg KB-R7943 【2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate】 50mg ￥70,500 RT 182004-65-5
　
　
Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 μM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 μM, 0

　 AST AST-132-50mg Ketanserin Tartrate 【3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt】【Selective 5HT2 Antagonist】 50mg ￥25,500 RT 83846-83-7
　
　
5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1Dα over 5HT1β, and affinity at α1 adrenoceptors. Antihypertensive in vivo.

　 AST AST-132-250mg Ketanserin Tartrate 【3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt】【Selective 5HT2 Antagonist】 250mg ￥56,100 RT 83846-83-7
　
　
5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1Dα over 5HT1β, and affinity at α1 adrenoceptors. Antihypertensive in vivo.

　 AST AST-181-1mg Kisspeptin-13 (4-13) 【AXOR12 Agonist】 (human) 1mg ￥40,200 -20℃ none
　
　
Agonist of AXOR12 receptor (pEC50 = 9.30). Peptide derived from KiSS-1. Recently shown to be a potent vasoconstrictor in rat aorta (pD2 = 11.64) Amino Acids Sequence:YNWNSFGLRF-NH2

　 AST AST-064-1g Kynurenic Acid 【4-Hydroxyquinoline-2-carboxylic Acid】【Endogenous Ionotropic /Nicotinic Antagonist】 1g ￥19,200 RT 492-27-3
　
　
Endogenous antagonist at ionotropic, Glycine β and α7 nicotinic receptors. Neuroprotective in vivo.

　 AST AST-256-1g Kynurenic Acid 【4-Hydroxyquinoline-2-carboxylic Acid】【Endogenous Ionotropic /Nicotinic Antagonist】, Na salt 1g ￥19,800 RT none
　
　
Endogenous antagonist at ionotropic, glycine and α7 nicotinic receptors. Neuroprotective in vivo. Water soluble form.

　 AST AST-188-1mg Locustatachykinin I 【Insect Tachykinin-related Peptide】 1mg ￥29,400 -20℃ 126985-97-5
　
　
Insect tachykinin-related peptide isolated from Locusta migratoria. Exhibits sequence homology with vertebrate tachykinins.

　 AST AST-184-5mg Luteinizing Hormone Releasing Hormone 5mg ￥22,800 -20℃ 33515-09-2
　
　
Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2

　 AST AST-184-10mg Luteinizing Hormone Releasing Hormone 10mg ￥45,300 -20℃ 33515-09-2
　
　
Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2

　 AST AST-243-5mg LY 294002 【2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one】【PI-3 Kinase Inhibitor】 5mg ￥26,400 +4℃ 154447-36-6
　
　
A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 μM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >

　 AST AST-243-25mg LY 294002 【2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one】【PI-3 Kinase Inhibitor】 25mg ￥65,700 +4℃ 154447-36-6
　
　
A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 μM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >

　 AST AST-199-1mg LY 341495 【(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid】 1mg ￥37,500 RT 201943-63-7
　
　
Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a

　 AST AST-199-5mg LY 341495 【(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid】 5mg ￥71,100 RT 201943-63-7
　
　
Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a

　 AST AST-173-10mg LY 354740 【(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid】 10mg ￥38,100 +4℃ none
　
　
Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto

　 AST AST-173-50mg LY 354740 【(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid】 50mg ￥118,800 +4℃ none
　
　
Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto

　 AST AST-196-10mg LY 379268 【(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid】 10mg ￥54,300 +4℃ 191471-52-0
　
　
Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto

　 AST AST-196-50mg LY 379268 【(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid】 50mg ￥191,100 +4℃ 191471-52-0
　
　
Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto

　 AST AST-201-10mg LY 456236 【(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl】 10mg ￥33,600 +4℃ none
　
　
Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.

　 AST AST-201-50mg LY 456236 【(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl】 50mg ￥97,800 +4℃ none
　
　
Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.

　 AST AST-252-10mg (RS)-MCGP, Na salt 【(R,S)-α-Methyl-4-carboxyphenylglycine, Na salt】 10mg ￥29,400 RT none
　
　
Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.

　 AST AST-252-50mg (RS)-MCGP, Na salt 【(R,S)-α-Methyl-4-carboxyphenylglycine, Na salt】 50mg ￥75,600 RT none
　
　
Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.

　 AST AST-033-10mg (R,S)-MCPG 【(R,S)-α-Methyl-4-carboxyphenylglycine】 10mg ￥27,900 +4℃ 146669-29-6
　
　
Group I / group II metabotropic glutamate receptor antagonist.

　 AST AST-033-50mg (R,S)-MCPG 【(R,S)-α-Methyl-4-carboxyphenylglycine】 50mg ￥67,500 +4℃ 146669-29-6
　
　
Group I / group II metabotropic glutamate receptor antagonist.

　 AST AST-059-10mg (S)-MCPG 【(S)-α-Methyl-4-carboxyphenylglycine】 10mg ￥35,400 +4℃ 150145-89-4
　
　
Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.

　 AST AST-059-50mg (S)-MCPG 【(S)-α-Methyl-4-carboxyphenylglycine】 50mg ￥104,100 +4℃ 150145-89-4
　
　
Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.

　 AST AST-249-50mg Memantine 【3,5-Dimethyl-1-adamantanamine】, HCl 50mg ￥24,300 RT 41100-52-1
　
　
Antagonist at the NMDA receptor. Acts as a fast, voltage-dependent, open channel NMDA receptor blocker. Used in the clinic to treat Alzheimer's Disease. Cognitive enhancer and anxiolytic in vivo.

　 AST AST-053 (R)-(-)-α-Methylhistamine, 2HBr 【(R)-1-(1H-Imidazol-4-yl)propan-2-amine】 - - - Discontinued ￥15,000 +4℃ 75614-87-8
　
　
Potent, selective H3 histamine receptor agonist which crosses the blood-brain barrier; inhibits histamine synthesis and release.

　 AST AST-119-10mg N-Methyllidocaine Iodide 【N-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide】【Anti-arrthymic】 10mg ￥24,300 +4℃ 29199-61-9
　
　
Anti-arrhythmic. Enhances phosphatidyl biosynthesis.

　 AST AST-119-50mg N-Methyllidocaine Iodide 【N-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide】【Anti-arrthymic】 50mg ￥55,500 +4℃ 29199-61-9
　
　
Anti-arrhythmic. Enhances phosphatidyl biosynthesis.

　 AST AST-072-5mg Methyllycaconitine Citrate 【[1α,4(S),6β,14α,16β]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate】【α7-Nicotinic Receptor 5mg ￥22,800 -20℃ 21019-30-7
　
　
Potent, selective antagonist at α7-containing nicotinic receptors.

　 AST AST-072-25mg Methyllycaconitine Citrate 【[1α,4(S),6β,14α,16β]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate】【α7-Nicotinic Receptor 25mg ￥51,600 -20℃ 21019-30-7
　
　
Potent, selective antagonist at α7-containing nicotinic receptors.

　 AST AST-068-10mg Mirtazepine 【1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine】【Antidepressant】【α2, 5HT2, 5HT3 Antagonist】 10mg ￥23,700 +4℃ 61337-67-5
　
　
Antagonist at α2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.

　 AST AST-068-50mg Mirtazepine 【1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine】【Antidepressant】【α2, 5HT2, 5HT3 Antagonist】 50mg ￥52,200 +4℃ 61337-67-5
　
　
Antagonist at α2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.

　 AST AST-028-10mg (-)-MK 801 Maleate 【5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate】 10mg ￥21,300 +4℃ 77086-19-2
　
　
Less active enantiomer than (+)-MK 801.

　 AST AST-028-50mg (-)-MK 801 Maleate 【5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate】 50mg ￥39,600 +4℃ 77086-19-2
　
　
Less active enantiomer than (+)-MK 801.

　 AST AST-027-10mg (+)-MK 801 Maleate 【Dizocilpine】【(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate】 10mg ￥21,300 +4℃ 77086-22-7
　
　
Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.

　 AST AST-027-50mg (+)-MK 801 Maleate 【Dizocilpine】【(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate】 50mg ￥40,500 +4℃ 77086-22-7
　
　
Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.

　 AST AST-245-10mg MMPIP 【6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one】【mGlu7 Allosteric Antagonist】 10mg ￥30,900 RT 479077-02-6
　
　
Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a

　 AST AST-245-50mg MMPIP 【6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one】【mGlu7 Allosteric Antagonist】 50mg ￥87,000 RT 479077-02-6
　
　
Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a

　 AST AST-137-10mg NG-Monomethyl-L-arginine, Monoacetate salt 【NG-Methyl-L-arginine Acetate salt】【NOS Inhibitor】 10mg ￥18,900 RT 53308-83-1
　
　
Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.

　 AST AST-137-50mg NG-Monomethyl-L-arginine, Monoacetate salt 【NG-Methyl-L-arginine Acetate salt】【NOS Inhibitor】 50mg ￥32,100 RT 53308-83-1
　
　
Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.

　 AST AST-008-10mg MPEP, HCl 【2-Methyl-6-(phenylethynyl)pyridine, HCl】 10mg ￥26,100 +4℃ 96206-92-7
　
　
Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.

　 AST AST-008-50mg MPEP, HCl 【2-Methyl-6-(phenylethynyl)pyridine, HCl】 50mg ￥60,000 +4℃ 96206-92-7
　
　
Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.

　 AST AST-205-5mg α-MSH (free acid) 【Endogenous Melanocortin Receptor Agonist】 5mg ￥40,800 -20℃ 10466-28-1
　
　
Free acid form of the endogenous melanocortin receptor agonist involved in feeding, homeostasis, body weight and inflammation. Amino Acids Sequence：Ac-SYSMEHFRWGKPV

　 AST AST-189-1mg α-MSH 【Endogenous Melanocortin Receptor Agonist】 1mg ￥21,900 -20℃ 581-05-5
　
　
Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2

　 AST AST-189-5mg α-MSH 【Endogenous Melanocortin Receptor Agonist】 5mg ￥40,800 -20℃ 581-05-5
　
　
Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2

　 AST AST-035-10mg MTEP, HCl 【3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl】 10mg ￥37,200 +4℃ none
　
　
Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side ffects seen with MPEP and benzodiazepi

　 AST AST-035-50mg MTEP, HCl 【3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl】 50mg ￥103,800 +4℃ none
　
　
Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side effects seen with MPEP and benzodiaze

　 AST AST-094-5mg Muscimol 【5-(Aminomethyl)isoxazol-3-ol】【Potent, selective GABAA Agonist】 5mg ￥25,200 +4℃ 2763-96-4
　
　
Potent, selective GABAA agonist.

　 AST AST-094-10mg Muscimol 【5-(Aminomethyl)isoxazol-3-ol】【Potent, selective GABAA Agonist】 10mg ￥28,500 +4℃ 2763-96-4
　
　
Potent, selective GABAA agonist.

　 AST AST-094-50mg Muscimol 【5-(Aminomethyl)isoxazol-3-ol】【Potent, selective GABAA Agonist】 50mg ￥67,500 +4℃ 2763-96-4
　
　
Potent, selective GABAA agonist.

　 AST AST-099-5mg NADA 【(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide】【Endogenous CB1 / TRPV1 Agonist】 5mg ￥24,300 -20℃ 199875-69-9
　
　
Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 μM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.

　 AST AST-099-25mg NADA 【(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide】【Endogenous CB1 / TRPV1 Agonist】 25mg ￥52,200 -20℃ 199875-69-9
　
　
Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 μM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.

　 AST AST-074-100mg Naloxone, HCl 【(5α)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl】 100mg ￥21,600 +4℃ 357-08-4
　
　
Competitive opioid antagonist.

　 AST AST-074-250mg Naloxone, HCl 【(5α)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl】 250mg ￥25,800 +4℃ 357-08-4
　
　
Competitive opioid antagonist.

　 AST AST-075-100mg Naltrexone, HCl 【(5α)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl】 100mg ￥22,200 +4℃ 16676-29-2
　
　
Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for μ, d, and k-receptors respectively.

　 AST AST-075-250mg Naltrexone, HCl 【(5α)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl】 250mg ￥29,700 +4℃ 16676-29-2
　
　
Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for μ, d, and k-receptors respectively.

　 AST AST-045-10mg NBQX 【2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide】 10mg ￥30,900 +4℃ 118876-58-7
　
　
Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.

　 AST AST-045-50mg NBQX 【2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide】 50mg ￥84,900 +4℃ 118876-58-7
　
　
Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.

　 AST AST-046-10mg NBQX, 2Na salt 【2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt】 10mg ￥34,200 +4℃ none
　
　
Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.

　 AST AST-046-50mg NBQX, 2Na salt 【2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt】 50mg ￥98,400 +4℃ none
　
　
Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.

　 AST AST-185-5mg Neurokinin A 5mg ￥29,400 -20℃ 86933-74-6
　
　
Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2

　 AST AST-185-25mg Neurokinin A 25mg ￥72,600 -20℃ 86933-74-6
　
　
Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2

　 AST AST-174-1mg Neuropeptide S 【NPS Receptor Agonist】 (mouse) 1mg ￥37,500 -20℃ none
　
　
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ

　 AST AST-246-1mg Neuropeptide S (mouse) 1mg ￥37,500 -20℃ none
　
　
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ

　 AST AST-208-0.5mg Neuropeptide S (rat) 0.5mg ￥45,000 -20℃ 412938-75-1
　
　
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ

　 AST AST-208-1mg Neuropeptide S (rat) 1mg ￥72,000 -20℃ 412938-75-1
　
　
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ

　 AST AST-171-1mg Neuropeptide Y (13-36) 【NPY Y2 Agonist】 (porcine) 1mg ￥40,800 -20℃ 113662-54-7
　
　
Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2

　 AST AST-171-5mg Neuropeptide Y (13-36) 【NPY Y2 Agonist】 (porcine) 5mg ￥117,000 -20℃ 113662-54-7
　
　
Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2

　 AST AST-145-10g Nicotinic Acid 【Pyridine-3-carboxylic Acid】【Antidyslipidemic Agent】 10g ￥17,400 RT 59-67-6
　
　
Antidyslipidemic. Increases high-density- and lowers low-density lipoproteins. Putative ligand for the HM74A receptor.

　 AST AST-135-250mg Nifedipine 【1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester】【L-type Ca2+ Channel Blocker】 250mg ￥19,200 +4℃ 21829-25-4
　
　
L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.

　 AST AST-135-1g Nifedipine 【1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester】【L-type Ca2+ Channel Blocker】 1g ￥22,500 +4℃ 21829-25-4
　
　
L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.

　 AST AST-138-100mg Nimodipine 【1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester】【L-type Ca2+ Channel Blocker】 100mg ￥21,900 ?弩� +4℃ 66085-59-4
　
　
L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.

　 AST AST-138-500mg Nimodipine 【1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester】【L-type Ca2+ Channel Blocker】 500mg ￥45,300 ?弩� +4℃ 66085-59-4
　
　
L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.

　 AST AST-312-100mg Nipecotic Acid 【(+/-)-3-Piperidine carboxylic Acid】 100mg ￥19,500 RT 60252-41-7
　
　
GABA reuptake inhibitor.

　 AST AST-312-1g Nipecotic Acid 【(+/-)-3-Piperidine carboxylic Acid】 1g ￥20,100 RT 60252-41-7
　
　
GABA reuptake inhibitor.

　 AST AST-312-5g Nipecotic Acid 【(+/-)-3-Piperidine carboxylic Acid】 5g ￥25,800 RT 60252-41-7
　
　
GABA reuptake inhibitor.

　 AST AST-139-100mg Nitrendipine 【1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester】【L-type Ca2+ Channel Blocker】 100mg ￥28,500 RT 39562-70-4
　
　
L-type Ca2+ channel blocker. Antihypertensive in vivo.

　 AST AST-139-500mg Nitrendipine 【1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester】【L-type Ca2+ Channel Blocker】 500mg ￥76,200 RT 39562-70-4
　
　
L-type Ca2+ channel blocker. Antihypertensive in vivo.

　 AST AST-136-100mg Nω-Nitro-L-arginine Methyl Ester, HCl 100mg ￥19,800 +4℃ 51298-62-5
　
　
Cell permeable NOS inhibitor. More soluble analogue of arginine. pIC50 values are 4.3, 5.7 and 5.6 at human iNOS, nNOA and eNOS respectively.

　 AST AST-233-50mg 7-Nitroindazole 【NOS Inhibitor】 50mg ￥19,800 -20℃ 2942-42-9
　
　
Competitive, reversible and non-selective NOS inhibitor. Neuroprotective, anticonvulsant and anxiolytic in vivo.

　 AST AST-285--10mg S-Nitrosoglutathione 10mg ￥21,900 -20℃ 57564-91-7
　
　
carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.

　 AST AST-285-50mg S-Nitrosoglutathione 50mg ￥45,300 -20℃ 57564-91-7
　
　
carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.

　 AST AST-063-10mg (S)-5-Nitrowillardiine 【(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 10mg ￥28,500 +4℃ none
　
　
Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors

　 AST AST-063-50mg (S)-5-Nitrowillardiine 【(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 50mg ￥68,100 +4℃ none
　
　
Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors

　 AST AST-190-10mg NKH 477 【N,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester β-alanine, HCl】 10mg ￥34,800 +4℃ 138605-00-2
　
　
Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator

　 AST AST-190-50mg NKH 477 【N,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester β-alanine, HCl】 50mg ￥102,300 +4℃ 138605-00-2
　
　
Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator

　 AST AST-052-50mg NMDA 【(R)-2-(Methylamino)succinic Acid】 50mg ￥21,600 +4℃ 6384-92-5
　
　
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.

　 AST AST-052-100mg NMDA 【(R)-2-(Methylamino)succinic Acid】 100mg ￥26,700 +4℃ 6384-92-5
　
　
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.

　 AST AST-052-500mg NMDA 【(R)-2-(Methylamino)succinic Acid】 500mg ￥44,400 +4℃ 6384-92-5
　
　
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.

　 AST AST-070-1mg Nociceptin 【ORL1 Agonist】 1mg ￥30,000 +4℃ 170713-75-4
　
　
Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH

　 AST AST-070-5mg Nociceptin 【ORL1 Agonist】 5mg ￥66,300 +4℃ 170713-75-4
　
　
Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH

　 AST AST-078-10mg Nor-Binaltorphimine, 2HCl 10mg ￥27,900 +4℃ 105618-26-6
　
　
Potent and selective κ-Opioid receptor antagonist

　 AST AST-078-50mg Nor-Binaltorphimine, 2HCl 50mg ￥71,100 +4℃ 105618-26-6
　
　
Potent and selective κ-Opioid receptor antagonist

　 AST AST-071-1mg Obestatin 1mg ￥24,000 +4℃ 869705-22-6
　
　
Obestatin, a peptide encoded by the ghrelin gene that suppresses food intake. Binds to the orphan G-protein-coupled receptor GPR39. Amino Acids Sequence:H-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-IIe-Lys-Leu-

　 AST AST-022-10mg ODQ 【1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one】 10mg ￥22,200 +4℃ 41443-28-1
　
　
Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.

　 AST AST-022-50mg ODQ 【1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one】 50mg ￥45,900 +4℃ 41443-28-1
　
　
Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.

　 AST AST-134-10mg Ondansetron 【2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one】【Selective 5HT3 Antagonist】 10mg ￥23,400 -20℃ 99614-02-5
　
　
Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.

　 AST AST-134-50mg Ondansetron 【2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one】【Selective 5HT3 Antagonist】 50mg ￥55,500 -20℃ 99614-02-5
　
　
Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.

　 AST AST-212-0.1mg Orexin A (bovine, human, mouse, rat) 0.1mg ￥30,000 -20℃ 205640-90-0
　
　
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14

　 AST AST-212-0.5mg Orexin A (bovine, human, mouse, rat) 0.5mg ￥54,000 -20℃ 205640-90-0
　
　
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14

　 AST AST-212-1mg Orexin A (bovine, human, mouse, rat) 1mg ￥93,000 -20℃ 205640-90-0
　
　
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14

　 AST AST-186-5mg Oxytocin 【Reproductive Hormone】 5mg ￥28,500 -20℃ 50-56-6
　
　
Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-

　 AST AST-186-25mg Oxytocin 【Reproductive Hormone】 25mg ￥69,900 -20℃ 50-56-6
　
　
Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-

　 AST AST-204-5mg Oxytocin 【Reproductive Hormone】, free-acid 5mg ￥28,500 -20℃ 24346-32-5
　
　
Free acid form of oxytocin, which is a hormone involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino A

　 AST AST-143-10mg Paclitaxel 【Anticancer Agent】 10mg ￥23,700 -20℃ 33069-62-4
　
　
Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.

　 AST AST-143-50mg Paclitaxel 【Anticancer Agent】 50mg ￥52,200 -20℃ 33069-62-4
　
　
Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.

　 AST AST-069-10mg Paroxetine, HCl 【(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl】【5HT Uptake Inhibitor】 10mg ￥23,400 +4℃ 110429-35-1
　
　
Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.

　 AST AST-069-50mg Paroxetine, HCl 【(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl】【5HT Uptake Inhibitor】 50mg ￥57,300 +4℃ 110429-35-1
　
　
Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.

　 AST AST-234-1mg PD 98059 【2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one】【MEK1 Inhibitor】 1mg ￥18,300 RT 167869-21-8
　
　
Inhibitor of MKK1 (MEK1).

　 AST AST-234-10mg PD 98059 【2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one】【MEK1 Inhibitor】 10mg ￥25,500 RT 167869-21-8
　
　
Inhibitor of MKK1 (MEK1).

　 AST AST-234-50mg PD 98059 【2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one】【MEK1 Inhibitor】 50mg ￥61,800 RT 167869-21-8
　
　
Inhibitor of MKK1 (MEK1).

　 AST AST-043-10mg PHCCC 【(E)-1,1α,7,7α-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1α-carboxamide】 10mg ￥28,200 +4℃ none
　
　
Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.

　 AST AST-043-50mg PHCCC 【(E)-1,1α,7,7α-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1α-carboxamide】 50mg ￥69,600 +4℃ none
　
　
Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.

　 AST AST-297-1mg Phorbol 12-Myristate 13-Acetate 1mg ￥20,400 -20℃ 16561-29-8
　
　
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non

　 AST AST-297-5mg Phorbol 12-Myristate 13-Acetate 5mg ￥34,200 -20℃ 16561-29-8
　
　
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non

　 AST AST-297-25mg Phorbol 12-Myristate 13-Acetate 25mg ￥84,000 -20℃ 16561-29-8
　
　
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non

　 AST AST-079-0.5mg Phospho-Glycogen Synthase Peptide-2 0.5mg ￥36,000 +4℃ none
　
　
Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE

　 AST AST-079-1mg Phospho-Glycogen Synthase Peptide-2 1mg ￥52,800 +4℃ none
　
　
Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE

　 AST AST-315-1g Picrotoxin 1g ￥18,300 -20℃ 124-87-8
　
　
Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin

　 AST AST-315-5g Picrotoxin 5g ￥29,100 -20℃ 124-87-8
　
　
Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin

　 AST AST-038-50mg 2,3 cis-Piperidine dicarboxylic Acid 【cis-PDA】【cis-Piperidine-2,3-dicarboxylic Acid】 50mg ￥35,100 +4℃ 46026-75-9
　
　
General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.

　 AST AST-038-250mg 2,3 cis-Piperidine dicarboxylic Acid 【cis-PDA】【cis-Piperidine-2,3-dicarboxylic Acid】 250mg ￥65,100 +4℃ 46026-75-9
　
　
General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.

　 AST AST-153-100mg Pirenzepine, 2HCl 【5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl】【M1 Antagonist】 100mg ￥19,200 RT 28797-61-7
　
　
Selective M1 receptor antagonist.

　 AST AST-153-500mg Pirenzepine, 2HCl 【5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl】【M1 Antagonist】 500mg ￥28,500 RT 28797-61-7
　
　
Selective M1 receptor antagonist.

　 AST AST-308-1mg PP2 【1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine】 1mg ￥27,000 +4℃ 172889-27-9
　
　
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1δ (IC50 values are 19 nM and 41 nM respectivel

　 AST AST-308-5mg PP2 【1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine】 5mg ￥34,500 +4℃ 172889-27-9
　
　
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1δ (IC50 values are 19 nM and 41 nM respectivel

　 AST AST-308-10mg PP2 【1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine】 10mg ￥40,500 +4℃ 172889-27-9
　
　
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1δ (IC50 values are 19 nM and 41 nM respectivel

　 AST AST-009-10mg PPADS 【4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt】 10mg ￥20,100 -20℃ 149017-66-3
　
　
P2 purinergic receptor antagonist.

　 AST AST-009-50mg PPADS 【4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt】 50mg ￥36,000 -20℃ 149017-66-3
　
　
P2 purinergic receptor antagonist.

　 AST AST-009-250mg PPADS 【4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt】 250mg ￥101,400 -20℃ 149017-66-3
　
　
P2 purinergic receptor antagonist.

　 AST AST-047-10mg cis-PPDA 【(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid】 10mg ￥28,800 +4℃ none
　
　
Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 μM, 0.125 μM, 0.55 μM and 0.31 μM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.

　 AST AST-047-50mg cis-PPDA 【(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid】 50mg ￥69,300 +4℃ none
　
　
Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 μM, 0.125 μM, 0.55 μM and 0.31 μM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.

　 AST AST-161-10mg PPT 【4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol】【Subtype selective ERα Agonist】 10mg ￥29,700 +4℃ 263717-53-9
　
　
Potent, subtype selective ERα estrogen receptor agonist. Over 400-fold selective for ERα over ERβ receptors.

　 AST AST-161-50mg PPT 【4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol】【Subtype selective ERα Agonist】 50mg ￥80,700 +4℃ 263717-53-9
　
　
Potent, subtype selective ERα estrogen receptor agonist. Over 400-fold selective for ERα over ERβ receptors.

　 AST AST-238-50mg Prazosin, HCl 【[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl】【α-Adrenoceptor Antagonist】 50mg ￥19,800 +4℃ 19237-84-4
　
　
Peripheral α1- and α2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.

　 AST AST-238-250mg Prazosin, HCl 【[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl】【α-Adrenoceptor Antagonist】 250mg ￥36,900 +4℃ 19237-84-4
　
　
Peripheral α1- and α2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.

　 AST AST-334-1g Propofol 【2,6-Diisopropylphenol】 1g ￥18,000 RT 2078-54-8
　
　
GABAA agonist. Short-acting intravenous anaesthetic agent. Stimulates constitutive nitric oxide (NO) production and inhibits inducible NO production. Also has anxiolytic properties, antioxidant, immun

　 AST AST-304-1mg Purvalanol A 【(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol】 1mg ￥22,500 +4℃ 212844-53-6
　
　
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 μM respectively).

　 AST AST-304-10mg Purvalanol A 【(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol】 10mg ￥31,500 +4℃ 212844-53-6
　
　
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 μM respectively).

　 AST AST-304-50mg Purvalanol A 【(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol】 50mg ￥87,000 +4℃ 212844-53-6
　
　
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 μM respectively).

　 AST AST-305-10mg Purvalanol B 【4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid】 10mg ￥31,500 +4℃ 212844-54-7
　
　
Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas

　 AST AST-305-50mg Purvalanol B 【4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid】 50mg ￥87,000 +4℃ 212844-54-7
　
　
Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas

　 AST AST-247-100mg Quercetin 【2-(3,4-Dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one】 100mg ￥19,500 RT 6151-25-3
　
　
Anti-oxidative flavonoid. Anticancer, antithrombotic and anti-inflammatory agent. Actions include inhibition of mitochondrial ATPase, phosphodiesterases, PI3-kinase and PIP kinase activity.

　 AST AST-010-5mg Quisqualic Acid 【L-(+)-α-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid】 5mg ￥23,700 +4℃ 52809-07-1
　
　
Potent group I mGlu agonist and AMPA receptor agonist.

　 AST AST-010-10mg Quisqualic Acid 【L-(+)-α-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid】 10mg ￥30,600 +4℃ 52809-07-1
　
　
Potent group I mGlu agonist and AMPA receptor agonist.

　 AST AST-010-50mg Quisqualic Acid 【L-(+)-α-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid】 50mg ￥90,300 +4℃ 52809-07-1
　
　
Potent group I mGlu agonist and AMPA receptor agonist.

　 AST AST-126-10mg QX-222 【N-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride】【Na+ Channel Blocker】 10mg ￥20,100 -20℃ 21236-55-5
　
　
Na+ channel blocker. Lidocaine derivative.

　 AST AST-126-50mg QX-222 【N-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride】【Na+ Channel Blocker】 50mg ￥35,400 -20℃ 21236-55-5
　
　
Na+ channel blocker. Lidocaine derivative.

　 AST AST-117-50mg QX-314 Bromide 【N-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide】【Na+ Channel Blocker】 50mg ￥21,600 +4℃ 21306-56-9
　
　
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.

　 AST AST-117-100mg QX-314 Bromide 【N-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide】【Na+ Channel Blocker】 100mg ￥27,000 +4℃ 21306-56-9
　
　
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.

　 AST AST-118-50mg QX-314 Chloride 【N-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Chloride】【Na+ Channel Blocker】 50mg ￥24,300 +4℃ 5369-03-9
　
　
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ channels

　 AST AST-224-1mg Rapamycin 【Immunosuppressant】 1mg ￥32,400 -20℃ 53123-88-9
　
　
Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin

　 AST AST-224-5mg Rapamycin 【Immunosuppressant】 5mg ￥95,700 -20℃ 53123-88-9
　
　
Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin

　 AST AST-236-10mg Rasagiline Mesylate 【(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate】 10mg ￥21,000 +4℃ 161735-79-1
　
　
Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti

　 AST AST-236-50mg Rasagiline Mesylate 【(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate】 50mg ￥31,500 +4℃ 161735-79-1
　
　
Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti

　 AST AST-157-10mg Reboxetine Mesylate 【(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine】【Noradrenaline Reuptake Inhibitor】 10mg ￥26,400 +4℃ 71620-89-8
　
　
Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.

　 AST AST-157-50mg Reboxetine Mesylate 【(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine】【Noradrenaline Reuptake Inhibitor】 50mg ￥60,300 +4℃ 71620-89-8
　
　
Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.

　 AST AST-272-10mg Riluzole 【2-Amino-6-trifluoromethoxybenzothiazole, HCl】 10mg ￥19,200 RT 1744-22-5
　
　
Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,

　 AST AST-272-50mg Riluzole 【2-Amino-6-trifluoromethoxybenzothiazole, HCl】 50mg ￥28,500 RT 1744-22-5
　
　
Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,

　 AST AST-031-10mg (R)-(-)-Rolipram 【(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one】 10mg ￥33,000 +4℃ 85416-75-7
　
　
Selective PDE4 inhibitor (IC50 = 0.22 μM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.

　 AST AST-031-50mg (R)-(-)-Rolipram 【(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one】 50mg ￥85,200 +4℃ 85416-75-7
　
　
Selective PDE4 inhibitor (IC50 = 0.22 μM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.

　 AST AST-029-10mg (R,S)-Rolipram 【(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one】 10mg ￥24,000 +4℃ 61413-54-5
　
　
Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 μM and 0.17 μM for inhibition of mouse PDE4A1 and PDE4B respectively)

　 AST AST-029-50mg (R,S)-Rolipram 【(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one】 50mg ￥48,600 +4℃ 61413-54-5
　
　
Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 μM and 0.17 μM for inhibition of mouse PDE4A1 and PDE4B respectively)

　 AST AST-030-10mg (S)-(+)-Rolipram 【(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one】 10mg ￥32,100 +4℃ 85416-73-5
　
　
PDE4 inhibitor (IC50 = 0.58 μM). Less active enantiomer.

　 AST AST-030-50mg (S)-(+)-Rolipram 【(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one】 50mg ￥83,400 +4℃ 85416-73-5
　
　
PDE4 inhibitor (IC50 = 0.58 μM). Less active enantiomer.

　 AST AST-290-1mg Ro 25-6981 Maleate 【[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate】 1mg ￥21,300 RT 169274-78-6
　
　
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 μM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant

　 AST AST-290-10mg Ro 25-6981 Maleate 【[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate】 10mg ￥29,100 RT 169274-78-6
　
　
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 μM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant

　 AST AST-290-50mg Ro 25-6981 Maleate 【[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate】 50mg ￥77,700 RT 169274-78-6
　
　
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 μM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant

　 AST AST-264-100mg Ruthenium Red 100mg ￥19,500 RT 11103-72-3
　
　
Inhibitor of calcium signalling with multiple actions. Inhibits the mitochondrial Ca2+ uniporter, Ca2+-ATPase, troponin C and calmodulin. Attenuates capsaicin-induced cation channel opening. Inhibits

　 AST AST-083-1mg Ryanodine 【1H-Pyrrole-2-carboxylic Acid, (3S,4R,4αR,6S,7S,8R,8αS,8βR,9S,9αS)-Dodecahydro-4,6,7,8α,8β,9α-hexahydroxy- 3,6α,9-trimethyl-7-(1-methylethyl)-6,9-methanobenzo[1,2] pentaleno[1,6-bc 1mg ￥32,100 -20℃ 15662-33-6
　
　
Alkaloid that binds with high affinity to ryanodine receptors to modulate intracellular Ca2+ release. Has complex actions and may stimulate or inhibit Ca2+ release, depending on the concentration used

　 AST AST-327-10mg Saclofen 【3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid】 10mg ￥28,500 RT 125464-42-8
　
　
GABAB antagonist

　 AST AST-327-50mg Saclofen 【3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid】 50mg ￥74,700 RT 125464-42-8
　
　
GABAB antagonist

　 AST AST-084 Salvinorin A <<< 輸入禁?� >>> ￥15,000 83729-01-5
　
　
Potent κ agonist (Ki = 8-19 nM). Psychoactive and antinociceptive in vivo. Reported to be an allosteric modulator of μ opiod receptors.

　 AST AST-182-1mg SAMS peptide 【AMP-activated Protein Kinase Substrate】 1mg ￥36,300 -20℃ 125911-68-4
　
　
Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR

　 AST AST-182-5mg SAMS peptide 【AMP-activated Protein Kinase Substrate】 5mg ￥99,600 -20℃ 125911-68-4
　
　
Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR

　 AST AST-162-1mg SB 203580 【4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine】 1mg ￥23,100 +4℃ 152121-47-6
　
　
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.

　 AST AST-162-10mg SB 203580 【4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine】 10mg ￥32,700 +4℃ 152121-47-6
　
　
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.

　 AST AST-162-50mg SB 203580 【4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine】 50mg ￥94,800 +4℃ 152121-47-6
　
　
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.

　 AST AST-202-1mg SB 216763 【3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione】 1mg ￥21,300 +4℃ 280744-09-4
　
　
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3α). Has little activity against 24 other protein kinases (IC50 > 10 μM). Stimulates glycogen synthesis, gene tra

　 AST AST-202-10mg SB 216763 【3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione】 10mg ￥28,800 +4℃ 280744-09-4
　
　
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3α). Has little activity against 24 other protein kinases (IC50 > 10 μM). Stimulates glycogen synthesis, gene tra

　 AST AST-202-50mg SB 216763 【3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione】 50mg ￥78,000 +4℃ 280744-09-4
　
　
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3α). Has little activity against 24 other protein kinases (IC50 > 10 μM). Stimulates glycogen synthesis, gene tra

　 AST AST-163-1mg SB431542 【4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide】 1mg ￥22,800 RT 301836-41-9
　
　
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.

　 AST AST-163-10mg SB431542 【4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide】 10mg ￥27,300 RT 301836-41-9
　
　
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.

　 AST AST-163-50mg SB431542 【4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide】 50mg ￥36,600 RT 301836-41-9
　
　
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.

　 AST AST-235-10mg SB 203580, HCl 【4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine, HCl】【p38 MAP Kinase Inhibitor; water soluble】 10mg ￥34,500 +4℃ 152121-47-6 (free base)
　
　
Water soluble, cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.

　 AST AST-062-10mg (S)-5-Chlorowillardiine 【(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】【AMPA / Kainate Agonist】 10mg ￥28,500 +4℃ none
　
　
Potent AMPA / kainate receptor agonist

　 AST AST-062-50mg (S)-5-Chlorowillardiine 【(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】【AMPA / Kainate Agonist】 50mg ￥68,100 +4℃ none
　
　
Potent AMPA / kainate receptor agonist

　 AST AST-048-1g D-Serine 【(R)-2-Amino-3-hydroxypropanoic Acid】 1g ￥21,300 +4℃ 56-45-1
　
　
Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.

　 AST AST-048-5g D-Serine 【(R)-2-Amino-3-hydroxypropanoic Acid】 5g ￥24,900 +4℃ 56-45-1
　
　
Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.

　 AST AST-280-10mg SKF 96365 【1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl】 10mg ￥28,800 RT 130495-35-1
　
　
Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .

　 AST AST-280-50mg SKF 96365 【1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl】 50mg ￥77,400 RT 130495-35-1
　
　
Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .

　 AST AST-250-10mg SKF 97541 【3-Aminopropyl(methyl)phosphinic Acid】 10mg ￥29,100 RT 127729-35-5
　
　
Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 μM for SKF97541 and baclofen respectively.

　 AST AST-250-50mg SKF 97541 【3-Aminopropyl(methyl)phosphinic Acid】 50mg ￥75,600 RT 127729-35-5
　
　
Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 μM for SKF97541 and baclofen respectively.

　 AST AST-326-10ｍｇ SKF 89976A, HCl 【1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl】 10mg ￥29,400 +4℃ 85375-15-1
　
　
A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 μM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu

　 AST AST-326-50mg SKF 89976A, HCl 【1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl】 50mg ￥78,000 +4℃ 85375-15-1
　
　
A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 μM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu

劇物 AST AST-082-10mg SL 327 【α-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile】 10mg ￥37,200 +4℃ 305350-87-2
　
　
Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 μM and 0.22 μM respectively).

劇物 AST AST-082-25mg SL 327 【α-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile】 25mg ￥56,700 +4℃ 305350-87-2
　
　
Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 μM and 0.22 μM respectively).

　 AST AST-176-1mg SLIGRL-NH2 【PAR2 Agonist Peptide】 1mg ￥25,500 -20℃ 171436-38-7
　
　
Proteinase-activated receptor-2 activating (PAR2) agonist peptide. Amino Acids Sequence:SLIGRL-NH2

　 AST AST-014-10mg SNAP 【S-Nitroso-N-acetyl-DL-penicillamine】 10mg ￥20,400 -20℃ 67776-06-1
　
　
NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.

　 AST AST-014-50mg SNAP 【S-Nitroso-N-acetyl-DL-penicillamine】 50mg ￥33,900 -20℃ 67776-06-1
　
　
NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.

　 AST AST-259-10ug SNX 482 10ug ￥28,800 -20℃ 203460-30-4
　
　
Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (α1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent

　 AST AST-259-0.1mg SNX 482 0.1mg ￥126,000 -20℃ 203460-30-4
　
　
Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (α1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent

　 AST AST-065-10mg SP600125 【1,9-Pyrazoloanthrone】 10mg ￥24,600 +4℃ 129-56-6
　
　
Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 μM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the

　 AST AST-065-50mg SP600125 【1,9-Pyrazoloanthrone】 50mg ￥52,200 +4℃ 129-56-6
　
　
Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 μM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the

　 AST AST-057-100mg Spermidine, 3HCl 【N-(3-Aminopropyl)butane-1,4-diamine, 3HCl】 100mg ￥20,100 +4℃ 334-50-9
　
　
Endogenous polyamine, that binds to the polyamine modulatory site of the NMDA receptor. Inhibits neuronal nitric oxide synthase (nNOS). Binds and precipitates DNA; may be used for purification of DNA

　 AST AST-051-100mg Spermine 【N1,N4-bis(3-Aminopropyl)butane-1,4-diamine】 100mg ￥18,300 +4℃ 77-44-3
　
　
Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.

　 AST AST-051-1g Spermine 【N1,N4-bis(3-Aminopropyl)butane-1,4-diamine】 1g ￥21,300 +4℃ 77-44-3
　
　
Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.

　 AST AST-042-10mg SR95531 【Gabazine】【2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide】 10mg ￥27,000 +4℃ 104105-50-9
　
　
Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.

　 AST AST-042-50mg SR95531 【Gabazine】【2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide】 50mg ￥62,400 +4℃ 104105-50-9
　
　
Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.

　 AST AST-056-0.1mg Staurosporine 【[9S-(9α,10β,11β,13α)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3’,2’,1’-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one】 0.1mg ￥26,400 +4℃ 62996-74-1
　
　
Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)

　 AST AST-056-0.5mg Staurosporine 【[9S-(9α,10β,11β,13α)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3’,2’,1’-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one】 0.5mg ￥55,800 +4℃ 62996-74-1
　
　
Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)

　 AST AST-170-1mg Substanvce P 【Sensory Neuropeptide】 1mg ￥19,500 -20℃ 33507-63-0
　
　
Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2

　 AST AST-170-5mg Substanvce P 【Sensory Neuropeptide】 5mg ￥28,800 -20℃ 33507-63-0
　
　
Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2

　 AST AST-276-100mg tBuBHQ 【2,5-Di-tert-butylhydroquinone】 100mg ￥19,500 RT 88-58-4
　
　
Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor

　 AST AST-276-500mg tBuBHQ 【2,5-Di-tert-butylhydroquinone】 500mg ￥33,000 RT 88-58-4
　
　
Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor

　 AST AST-270-100mg Terfenadin 【1-(4-tert-Butylphenyl)-4-[4-(hydroxydiphenylmethyl)piperidin-1-yl]butan-1-ol】 100mg ￥38,100 +4℃ 50679-08-8
　
　
K+ channel blocker (Kv11.1). Blocks ATP-sensitive K+ channels (IC50 = 1.2 μM). H1 receptor antagonist.

　 AST AST-275-50mg N,N,N,N-Tetraethylammonium Chloride 【TEA】 50mg ￥19,500 RT 56-34-8
　
　
Non-selective K+ channel blocker (6TM family of K+ channels).

　 AST AST-054-1mg Tetrodotoxin 【Octahydro-12-(hydroxymethyl)-2-imino-5,9:7,10α-dimethano-10αH-[1,3]dioxocino[6,5-d]pyrimidine-4,7,10,11,12-pentol】 1mg ￥31,200 -20℃ 4368-28-9
　
　
Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.

　 AST AST-055-1mg Tetrodotoxin Citrate 1mg ￥32,400 -20℃ 18660-81-6
　
　
Water soluble citrate salt of tetrodotoxin. Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.

　 AST AST-177-1mg TFLLR-NH2 【PAR1 Agonist Peptide】 1mg ￥36,000 -20℃ 197794-83-5
　
　
Proteinase-activated receptor-1 activating (PAR1) agonist peptide. Amino Acids Sequence:TFLLR-NH2

　 AST AST-032-100mg (+/-)-Thalidomide 【N-(2,6-Dioxo-3-piperidinyl)phthalimide】 100mg ￥21,300 +4℃ 50-35-1
　
　
Immunomodulator. Antiproliferative, anti-angiogenic and pro-apoptotic.

　 AST AST-286-1mg Thapsigargin 1mg ￥22,800 -20℃ 67526-95-8
　
　
A potent, cell-permeable Ca2+-ATPase inhibitor. Releases Ca2+ by inhibiting endoplasmic reticular Ca2+-ATPase (IC50 = 4-13 nM). Both tumorogenic and apoptotic actions reported.

　 AST AST-021-10mg Thioperamide Maleate 【N-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate】 10mg ￥25,500 +4℃ 106243-16-7
　
　
Potent, selective H3 antagonist that crosses the blood-brain barrier.

　 AST AST-021-50mg Thioperamide Maleate 【N-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate】 50mg ￥53,400 +4℃ 106243-16-7
　
　
Potent, selective H3 antagonist that crosses the blood-brain barrier.

　 AST AST-237-10mg Tiagabine, HCl 【(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl】 10mg ￥21,000 +4℃ 115103-54-3 (free base)
　
　
GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.

　 AST AST-237-50mg Tiagabine, HCl 【(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl】 50mg ￥31,500 +4℃ 115103-54-3 (free base)
　
　
GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.

　 AST AST-289-10mg TMCB 【2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid】 10mg ￥22,500 RT 905105-89-7
　
　
CK2 inhibitor (Ki = 0.25 μM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 μM respectively) and a more favourable

　 AST AST-289-50mg TMCB 【2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid】 50mg ￥46,500 RT 905105-89-7
　
　
CK2 inhibitor (Ki = 0.25 μM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 μM respectively) and a more favourable

　 AST AST-278-100mg Tolubutamide 【1-Butyl-3-tosylurea】 100mg ￥19,500 RT 64-77-7
　
　
Blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.

　 AST AST-156-10mg Tropisetron, HCl 【(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl】【5-HT3 Antagonist】 10mg ￥25,800 RT 105826-92-4
　
　
5HT3 agonist. Potent, orally active anti-emetic. Also α7 nicotinic receptor partial agonist.

　 AST AST-156-50mg Tropisetron, HCl 【(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl】【5-HT3 Antagonist】 50mg ￥58,200 RT 105826-92-4
　
　
5HT3 agonist. Potent, orally active anti-emetic. Also α7 nicotinic receptor partial agonist.

劇物 AST AST-073-10mg (+)-Tubocurarine 【(+)-Tubocurarine chloride】【ACh Receptor Antagonist】 10mg ￥17,400 +4℃ 57-94-3
　
　
Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis

劇物 AST AST-073-50mg (+)-Tubocurarine 【(+)-Tubocurarine chloride】【ACh Receptor Antagonist】 50mg ￥18,900 +4℃ 57-94-3
　
　
Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis

　 AST AST-296-10mg Tunicamycin from Streptomyces sp. 10mg ￥30,000 +4℃ 11089-65-9
　
　
Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho

　 AST AST-296-50mg Tunicamycin from Streptomyces sp. 50mg ￥82,500 +4℃ 11089-65-9
　
　
Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho

劇物 AST AST-241-5mg U0126 【1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene】【Selective MKK Inhibitor】 5mg ￥31,200 +4℃ 109511-58-2
　
　
Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 μM respectively) and MKK5 with little or no effect on a wide range of other kinases.

劇物 AST AST-241-25mg U0126 【1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene】【Selective MKK Inhibitor】 25mg ￥96,000 +4℃ 109511-58-2
　
　
Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 μM respectively) and MKK5 with little or no effect on a wide range of other kinases.

　 AST AST-101-10mg U 93631 【tert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate】 10mg ￥28,500 RT 152273-12-6
　
　
GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c

　 AST AST-101-50mg U 93631 【tert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate】 50mg ￥69,000 RT 152273-12-6
　
　
GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c

　 AST AST-193-10mg UBP141 【(2R*,3S*)-1-(Phenanthrenyl-3-carbonyl)piperazine-2,3-dicarboxylic Acid】【NR2D Antagonist, with some subunit selectivity】 10mg ￥29,400 +4℃ none
　
　
NR2D antagonist, displaying modest subunit selectivity. Shows 7-fold selectivity for NR2C and/or NR2D-containing NMDA receptors and 5-fold selectivity over NR2A-containing receptors.

　 AST AST-194-10mg UBP304 【(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione】【Potent, selective GLUK5 Receptor Antagonist】 10mg ￥36,600 RT none
　
　
Potent, selective GLUK5 receptor antagonist (Kd = 105 nM). Selective over homomeric GLUK6, GLUK7 and GLUA1-4 AMPA receptors (IC50 >100 μM), and displays over 500-fold selectivity over NMDA or Group I

　 AST AST-195-10mg UBP308 【(R)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione】【Inactive Isomer of the GLUK5 Receptor Antagonist UBP304】 10mg ￥36,600 RT none
　
　
Inactive isomer of the potent, selective GLUK5 receptor antagonist UBP 304 (#Asc-194).

　 AST AST-168-10mg UBP310 【(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione】 10mg ￥42,000 +4℃ none
　
　
GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 μM at recombinant human GLUA2 (formerly

　 AST AST-168-50mg UBP310 【(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione】 50mg ￥135,000 +4℃ none
　
　
GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 μM at recombinant human GLUA2 (formerly

劇物 AST AST-309-1mg UCPH-101 【2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile】 1mg ￥28,500 +4℃ 1118460-77-7
　
　
Potent, selective inhibitor of EAAT1 (IC50 = 0.66 μM ). Displays >400-fold selectivity over EAAT2 and EAAT3.

　 AST AST-309-10mg UCPH-101 【2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile】 10mg ￥46,500 +4℃ 1118460-77-7
　
　
Potent, selective inhibitor of EAAT1 (IC50 = 0.66 μM ). Displays >400-fold selectivity over EAAT2 and EAAT3.

　 AST AST-175-1mg (Arg-8)-Vasopressin 【Vasopressin Receptor Agonist】 1mg ￥24,300 -20℃ 113-79-1
　
　
Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence：CYFQNCPRG-NH2 disulfide bridge 1-6

　 AST AST-175-5mg (Arg-8)-Vasopressin 【Vasopressin Receptor Agonist】 5mg ￥51,900 -20℃ 113-79-1
　
　
Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence：CYFQNCPRG-NH2 disulfide bridge 1-6

劇物 AST AST-140-1g Verapamil, HCl 【L-type Ca2+ Channel Blocker】 1g ￥21,300 RT 152-11-4
　
　
L-type Ca2+ channel blocker. Antiarrhythmic in vivo.

　 AST AST-279-10mg Veratridine 10mg ￥27,000 -20℃ 71-62-5
　
　
Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.

　 AST AST-279-50mg Veratridine 50mg ￥69,000 -20℃ 71-62-5
　
　
Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.

　 AST AST-226-5mg Vincristine Sulfate 5mg ￥21,300 -20℃ 2068-78-2
　
　
Anticancer agent; microtubule disrupter.

　 AST AST-226-25mg Vincristine Sulfate 25mg ￥42,000 -20℃ 2068-78-2
　
　
Anticancer agent; microtubule disrupter.

　 AST AST-180-1mg VIP (6-28) 【VPAC Antagonist】 1mg ￥34,500 -20℃ 69698-54-0
　
　
VPAC antagonist. Amino Acids Sequence:FTDNYTRLRKQMAVKKYLNSILN-NH2

　 AST AST-244-10mg VU 0155041 【cis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid】【PAM for mGluR4】 10mg ￥21,600 RT none
　
　
Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and

　 AST AST-244-50mg VU 0155041 【cis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid】【PAM for mGluR4】 50mg ￥40,500 RT none
　
　
Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and

　 AST AST-248-10mg VU 0155041 【cis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid】【PAM for mGluR4】, Na salt 10mg ￥22,200 RT none
　
　
Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat

　 AST AST-248-50mg VU 0155041 【cis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid】【PAM for mGluR4】, Na salt 50mg ￥43,500 RT none
　
　
Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat

　 AST AST-165-10mg 1400W 【N-(3-(Aminomethyl)benzyl)acetamidine, 2HCl】 10mg ￥24,600 +4℃ 180001-34-7
　
　
Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 μM and 50 μM at human iNOS, nNOS and eNOS respectively).

　 AST AST-165-50mg 1400W 【N-(3-(Aminomethyl)benzyl)acetamidine, 2HCl】 50mg ￥58,500 +4℃ 180001-34-7
　
　
Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 μM and 50 μM at human iNOS, nNOS and eNOS respectively).

　 AST AST-040-10mg (S)-Willardiine 【(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 10mg ￥29,400 +4℃ 21416-43-3
　
　
Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 μM) over hGluR2 (Ki = 0.90 μM); hGluR4 (Ki = 8.85 μM) and Kainate receptor hGluR5 (Ki = 28.9 μM). Produces strong desensitisation.

　 AST AST-040-50mg (S)-Willardiine 【(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid】 50mg ￥74,400 +4℃ 21416-43-3
　
　
Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 μM) over hGluR2 (Ki = 0.90 μM); hGluR4 (Ki = 8.85 μM) and Kainate receptor hGluR5 (Ki = 28.9 μM). Produces strong desensitisation.

　 AST AST-148-1mg Wortmannin 【PI3-Kinase Inhibitor】 1mg ￥21,900 -20℃ 19545-26-7
　
　
Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)

　 AST AST-148-5mg Wortmannin 【PI3-Kinase Inhibitor】 5mg ￥42,000 -20℃ 19545-26-7
　
　
Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)

　 AST AST-089-10mg XE-991, 2HCl 【10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl】 10mg ￥26,700 +4℃ 122955-42-4
　
　
Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 μM (M-current), 0.71 μM (KCNQ 2), 0.75 μM (KCNQX 1), >100 μM (Kv1.2) and >43 μM (Kv4.

　 AST AST-089-50mg XE-991, 2HCl 【10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl】 50mg ￥67,500 +4℃ 122955-42-4
　
　
Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 μM (M-current), 0.71 μM (KCNQ 2), 0.75 μM (KCNQX 1), >100 μM (Kv1.2) and >43 μM (Kv4.

　 AST AST-129-1mg Y-27632, 2HCl 【(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl】【Selective Rho Kinase Inhibitor】 1mg ￥25,800 +4℃ 146986-50-7
　
　
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 μM for ROCKI, ROCKII, PKCα, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.

　 AST AST-129-10mg Y-27632, 2HCl 【(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl】【Selective Rho Kinase Inhibitor】 10mg ￥34,500 +4℃ 146986-50-7
　
　
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 μM for ROCKI, ROCKII, PKCα, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.

　 AST AST-129-50mg Y-27632, 2HCl 【(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl】【Selective Rho Kinase Inhibitor】 50mg ￥99,000 +4℃ 146986-50-7
　
　
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 μM for ROCKI, ROCKII, PKCα, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.

　 AST AST-293-10mg YM 202074 【N-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide】 10mg ￥36,000 +4℃ 299900-83-7
　
　
Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.

　 AST AST-293-50mg YM 202074 【N-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide】 50mg ￥115,500 +4℃ 299900-83-7
　
　
Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.

　 AST AST-015-10mg YM298198 【6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide】 10mg ￥30,600 +4℃ 748758-45-4
　
　
Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 μM). Orally active analgesic in vivo.

　 AST AST-015-50mg YM298198 【6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide】 50mg ￥84,300 +4℃ 748758-45-4
　
　
Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 μM). Orally active analgesic in vivo.

　 AST AST-239-1g Yohimbine, HCl 【(16α,17α)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl】 1g ￥18,600 RT 65-19-0
　
　
Selective α2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human α2A, α2B and α2C receptors respectively).

　 AST AST-239-5g Yohimbine, HCl 【(16α,17α)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl】 5g ￥32,100 RT 65-19-0
　
　
Selective α2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human α2A, α2B and α2C receptors respectively).

　 AST AST-102-10mg ZD7288 【ICI D7288】【4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride】 10mg ￥27,900 +4℃ 133059-99-1
　
　
Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.

　 AST AST-102-50mg ZD7288 【ICI D7288】【4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride】 50mg ￥66,600 +4℃ 133059-99-1
　
　
Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.

　 AST AST-218-10mg ZM 241385 【4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol】【Potent, selective A2A Antagonist】 10mg ￥28,800 RT 139180-30-6
　
　
Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 μM at human cloned A2A, A2B, A1 and A3 receptors respectively. O

　 AST AST-218-50mg ZM 241385 【4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol】【Potent, selective A2A Antagonist】 50mg ￥78,000 RT 139180-30-6
　
　
Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 μM at human cloned A2A, A2B, A1 and A3 receptors respectively. O

　 AST AST-076-10mg Zopiclone 【4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester】 10mg ￥29,100 +4℃ 43200-80-2
　
　
Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.

　 AST AST-076-50mg Zopiclone 【4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester】 50mg ￥64,500 +4℃ 43200-80-2
　
　
Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.

ホーム

記載のないメーカー、商品についてもお気軽にお問い合わせ下さい。

当サイト及び弊社発行のカタログ記載の内容は、予告なく変更されることがございます。予めご了承ください。

このホームページに関するお問合せは
バイオリンクス株式会社
Biolinks K.K.
Eメール：info@biolinks.co.jp
住所：〒108-0014　東京都港区芝4-3-7エムジー田町ビル
ＴＥＬ：03-5443-6891
ＦＡＸ：03-5443-0271