¾¦ÉÊ°ìÍ÷

Ë¡Îá	¥Ö¥é¥ó¥É	¥«¥¿¥í¥°ÈÖ¹æ	¾¦ÉÊ̾	¥µ¥¤¥º	²Á³Ê	Êݸ²¹ÅÙ	£Ã£Á£Ó
¡¡	AST	AST-287-10mg	A23187 ¡ÚCalcium Ionophore¡Û	10mg	¾È²ñ	RT	52665-69-7
	¡¡ ¡¡ ¡¡ A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho
¡¡	AST	AST-287-50mg	A23187 ¡ÚCalcium Ionophore¡Û	50mg	¾È²ñ	RT	52665-69-7
	¡¡ ¡¡ ¡¡ A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho
·àʪ	AST	AST-335-10mg	A 769662 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û	10mg	¾È²ñ	RT	844499-71-4
	¡¡ ¡¡ ¡¡ Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 ¦ÌM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by
·àʪ	AST	AST-335-50mg	A 769662 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û	50mg	¾È²ñ	RT	844499-71-4
	¡¡ ¡¡ ¡¡ Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 ¦ÌM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by
¡¡	AST	AST-282-10mg	A 803467 ¡Ú5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide¡Û	10mg	¾È²ñ	RT	944261-79-4
	¡¡ ¡¡ ¡¡ Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 ¦ÌM). Shows no significant a
¡¡	AST	AST-282-50mg	A 803467 ¡Ú5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide¡Û	50mg	¾È²ñ	RT	944261-79-4
	¡¡ ¡¡ ¡¡ Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 ¦ÌM). Shows no significant a
¡¡	AST	AST-251-5mg	ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û	5mg	¾È²ñ	-20¡î	220556-69-4
	¡¡ ¡¡ ¡¡ Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.
¡¡	AST	AST-251-25mg	ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û	25mg	¾È²ñ	-20¡î	220556-69-4
	¡¡ ¡¡ ¡¡ Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.
¡¡	AST	AST-096-5mg	ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û in Ethanol Solution	5mg	¾È²ñ	-20¡î	220556-69-4
	¡¡ ¡¡ ¡¡ Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.
¡¡	AST	AST-096-25mg	ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û in Ethanol Solution	25mg	¾È²ñ	-20¡î	220556-69-4
	¡¡ ¡¡ ¡¡ Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.
¡¡	AST	AST-096-100mg	ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û	100mg	¾È²ñ	-20¡î	220556-69-4
	¡¡ ¡¡ ¡¡ Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.
¡¡	AST	AST-097-10mg	ACPA ¡Ú(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide¡Û¡ÚCB1 Agonist¡Û	10mg	¾È²ñ	-20¡î	229021-64-1
	¡¡ ¡¡ ¡¡ Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.
¡¡	AST	AST-097-50mg	ACPA ¡Ú(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide¡Û¡ÚCB1 Agonist¡Û	50mg	¾È²ñ	-20¡î	229021-64-1
	¡¡ ¡¡ ¡¡ Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.
¡¡	AST	AST-150-10mg	6,7-ADTN, HBr ¡Ú6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr¡Û¡ÚDopamine Agonist¡Û	10mg	¾È²ñ	+4¡î	13575-86-5
	¡¡ ¡¡ ¡¡ Dopamine D1 agonist
¡¡	AST	AST-150-50mg	6,7-ADTN, HBr ¡Ú6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr¡Û¡ÚDopamine Agonist¡Û	50mg	¾È²ñ	+4¡î	13575-86-5
	¡¡ ¡¡ ¡¡ Dopamine D1 agonist
¡¡	AST	AST-152-10mg	AF-DX 116 ¡Ú11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û	10mg	¾È²ñ	RT	102394-31-0
	¡¡ ¡¡ ¡¡ Selective M2 receptor antagonist.
¡¡	AST	AST-152-50mg	AF-DX 116 ¡Ú11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û	50mg	¾È²ñ	RT	102394-31-0
	¡¡ ¡¡ ¡¡ Selective M2 receptor antagonist.
¡¡	AST	AST-088-10mg	AM 251 ¡Ú1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide¡Û	10mg	¾È²ñ	+4¡î	183232-66-8
	¡¡ ¡¡ ¡¡ Cannabinoid CB1 receptor antagonist / inverse agonist
¡¡	AST	AST-088-50mg	AM 251 ¡Ú1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide¡Û	50mg	¾È²ñ	+4¡î	183232-66-8
	¡¡ ¡¡ ¡¡ Cannabinoid CB1 receptor antagonist / inverse agonist
¡¡	AST	AST-095-10mg	AM 404 ¡Ú(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚAnandamideTransport Inhibitor¡Û	10mg	¾È²ñ	-20¡î	198022-70-7
	¡¡ ¡¡ ¡¡ Competitive and selective anandamide transport inhibitor (IC50 = 1 ¦ÌM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep
¡¡	AST	AST-095-50mg	AM 404 ¡Ú(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚAnandamideTransport Inhibitor¡Û	50mg	¾È²ñ	-20¡î	198022-70-7
	¡¡ ¡¡ ¡¡ Competitive and selective anandamide transport inhibitor (IC50 = 1 ¦ÌM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep
¡¡	AST	AST-281-100mg	Amiloride	100mg	¾È²ñ	RT	2016-88-8
	¡¡ ¡¡ ¡¡ Epithelial sodium channel (eNaC) blocker. At higher concentrations, blocks the Na+/H+ exchange pathway. Also blocks transient reception potential cation (TRPC6 and TRPP3) channels.
¡¡	AST	AST-123-100mg	Aminoguanidine, HCl ¡ÚNOS Inhibitor¡Û	100mg	¾È²ñ	RT	1937-19-5
	¡¡ ¡¡ ¡¡ Irreversible inhibitor of iNOS, displaying 26-fold selectivity over nNOS. In vitro and in vivo inhibitor of the formation of glycosylation end products associated with diabetes and aging.
¡¡	AST	AST-122-100mg	4-Aminopyridine ¡ÚK+ Channel Blocker¡Û	100mg	¾È²ñ	RT	504-24-5
	¡¡ ¡¡ ¡¡ Potassium channel blocker. Blocks Kv channels. Convulsant, and useful tool to model epileptiform activity in vitro.
¡¡	AST	AST-011-10mg	AMN082, 2HCl ¡ÚN,N'-Dibenzhydrylethane-1,2-diamine, 2HCl¡Û	10mg	¾È²ñ	+4¡î	03027-13-8
	¡¡ ¡¡ ¡¡ Potent, selective, orally active and brain penetrant mGlu7 receptor agonist
¡¡	AST	AST-011-50mg	AMN082, 2HCl ¡ÚN,N'-Dibenzhydrylethane-1,2-diamine, 2HCl¡Û	50mg	¾È²ñ	+4¡î	03027-13-8
	¡¡ ¡¡ ¡¡ Potent, selective, orally active and brain penetrant mGlu7 receptor agonist
¡¡	AST	AST-130-10mg	(RS)-AMPA ¡Ú(RS)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û	10mg	¾È²ñ	RT	74341-63-2
	¡¡ ¡¡ ¡¡ Prototypic agonist for AMPA receptors.
¡¡	AST	AST-130-50mg	(RS)-AMPA ¡Ú(RS)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û	50mg	¾È²ñ	RT	74341-63-2
	¡¡ ¡¡ ¡¡ Prototypic agonist for AMPA receptors.
¡¡	AST	AST-005-5mg	(S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û	5mg	¾È²ñ	+4¡î	83643-88-3
	¡¡ ¡¡ ¡¡ AMPA agonist
¡¡	AST	AST-005-10mg	(S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û	10mg	¾È²ñ	+4¡î	83643-88-3
	¡¡ ¡¡ ¡¡ AMPA agonist
¡¡	AST	AST-005-50mg	(S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û	50mg	¾È²ñ	+4¡î	83643-88-3
	¡¡ ¡¡ ¡¡ AMPA agonist
¡¡	AST	AST-301-100ug	Amyloid ¦Â (1-42) (human)	100ug	¾È²ñ	-20¡î	107761-42-2
	¡¡ ¡¡ ¡¡ 42-residue amyloid ¦Â-protein fragment; the predominant form of amyloid ¦Â found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac
¡¡	AST	AST-301-1mg	Amyloid ¦Â (1-42) (human)	1mg	¾È²ñ	-20¡î	107761-42-2
	¡¡ ¡¡ ¡¡ 42-residue amyloid ¦Â-protein fragment; the predominant form of amyloid ¦Â found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac
¡¡	AST	AST-087-5mg	Anandamide ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous Cannabinoid¡Û	5mg	¾È²ñ	-20¡î	94421-68-8
	¡¡ ¡¡ ¡¡ Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.
¡¡	AST	AST-087-25mg	Anandamide ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous Cannabinoid¡Û	25mg	¾È²ñ	-20¡î	94421-68-8
	¡¡ ¡¡ ¡¡ Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.
¡¡	AST	AST-013-1mg	(+/-)-Anatoxin A Fumarate ¡Ú(+/-)-2-Acetyl-9-azabicyclo[4.2.1]non-2-ene Fumarate¡Û	1mg	¾È²ñ	+4¡î	64285-06-9
	¡¡ ¡¡ ¡¡ Potent nicotinic agonist
¡¡	AST	AST-183-5mg	Angiotensin II ¡ÚVasoconstrictor Peptide¡Û (human)	5mg	¾È²ñ	-20¡î	68521-88-0
	¡¡ ¡¡ ¡¡ Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino
¡¡	AST	AST-183-10mg	Angiotensin II ¡ÚVasoconstrictor Peptide¡Û (human)	10mg	¾È²ñ	-20¡î	68521-88-0
	¡¡ ¡¡ ¡¡ Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino
¡¡	AST	AST-316-50mg	Aniracetam ¡Ú1-(4-Anisoyl)pyrrolidin-2-one¡Û	50mg	¾È²ñ	RT	72432-10-1
	¡¡ ¡¡ ¡¡ Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.
¡¡	AST	AST-316-250mg	Aniracetam ¡Ú1-(4-Anisoyl)pyrrolidin-2-one¡Û	250mg	¾È²ñ	RT	72432-10-1
	¡¡ ¡¡ ¡¡ Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.
¡¡	AST	AST-001-100mg	DL-AP4 ¡ÚDL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚNMDA receptor Antagonist¡Û	100mg	¾È²ñ	+4¡î	20263-07-4
	¡¡ ¡¡ ¡¡ Selective group III mGlu receptor agonist
¡¡	AST	AST-001-1g	DL-AP4 ¡ÚDL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚNMDA receptor Antagonist¡Û	1g	¾È²ñ	+4¡î	20263-07-4
	¡¡ ¡¡ ¡¡ Selective group III mGlu receptor agonist
¡¡	AST	AST-002-10mg	L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û	10mg	¾È²ñ	+4¡î	23052-81-5
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist
¡¡	AST	AST-002-50mg	L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û	50mg	¾È²ñ	+4¡î	23052-81-5
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist
¡¡	AST	AST-253-100mg	L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û, Na salt	100mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Broad spectrum receptor antagonist - water soluble form.
¡¡	AST	AST-271-10mg	DL-AP5 ¡ÚDL-2-Amino-5-phosphonopentanoic Acid¡Û, Na salt	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist. Water soluble form.
¡¡	AST	AST-271-50mg	DL-AP5 ¡ÚDL-2-Amino-5-phosphonopentanoic Acid¡Û, Na salt	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist. Water soluble form.
¡¡	AST	AST-003-10mg	D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û	10mg	¾È²ñ	+4¡î	79055-68-8
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist
¡¡	AST	AST-003-50mg	D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û	50mg	¾È²ñ	+4¡î	79055-68-8
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist
¡¡	AST	AST-003-100mg	D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û	100mg	¾È²ñ	+4¡î	79055-68-8
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist
¡¡	AST	AST-268-500ug	Apamin	500ug	¾È²ñ	-20¡î	24345-16-2
	¡¡ ¡¡ ¡¡ Peptide neurotoxin that naturally occurs in Apis mellifera bee venom. Blocks small conductance Ca2+ activated K+ channels (SK). Selective for KCa2.1-2.3 (SK1-3) isoforms. Blocks hSK1, rSK2 and liver r
¡¡	AST	AST-124-100mg	2-APB ¡Ú2-Aminoethyl Diphenyl Borinate¡Û¡ÚCa2+ Release Modulator¡Û	100mg	¾È²ñ	+4¡î	524-95-8
	¡¡ ¡¡ ¡¡ Cell permeable, allosteric inhibitor of D-myo-inositol 1,4,5-trisphosphate (IP3) -induced Ca2+ release . Inhibits IP3-induced Cat2+ release without affecting IP3 receptor binding. Blocks store operate
¡¡	AST	AST-141-10mg	Apigenin ¡Ú4,5,7-Trihydroxyflavone¡Û	10mg	¾È²ñ	+4¡î	520-36-5
	¡¡ ¡¡ ¡¡ Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-¦ÊB.
¡¡	AST	AST-141-50mg	Apigenin ¡Ú4,5,7-Trihydroxyflavone¡Û	50mg	¾È²ñ	+4¡î	520-36-5
	¡¡ ¡¡ ¡¡ Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-¦ÊB.
¡¡	AST	AST-151-10mg	AQ-RA 741 ¡Ú11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û	10mg	¾È²ñ	RT	123548-16-3
	¡¡ ¡¡ ¡¡ Potent, selective M2 receptor antagonist.
¡¡	AST	AST-151-50mg	AQ-RA 741 ¡Ú11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û	50mg	¾È²ñ	RT	123548-16-3
	¡¡ ¡¡ ¡¡ Potent, selective M2 receptor antagonist.
·àʪ	AST	AST-098-5mg	2-Arachidonoylglycerol in Acetontrile	5mg	¾È²ñ	-20¡î	53847-30-6
	¡¡ ¡¡ ¡¡ Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.
·àʪ	AST	AST-098-25mg	2-Arachidonoylglycerol in Acetontrile	25mg	¾È²ñ	-20¡î	53847-30-6
	¡¡ ¡¡ ¡¡ Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.
¡¡	AST	AST-004-10mg	DL-ASP5 ¡ÚDL-(-)-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û	10mg	¾È²ñ	+4¡î	76326-31-3
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist.
¡¡	AST	AST-004-50mg	DL-ASP5 ¡ÚDL-(-)-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û	50mg	¾È²ñ	+4¡î	76326-31-3
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor glutamate site antagonist.
¡¡	AST	AST-179-1mg	AY-NH2 ¡ÚPAR4 Agonist Peptide¡Û	1mg	¾È²ñ	-20¡î	352017-71-1
	¡¡ ¡¡ ¡¡ Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2
¡¡	AST	AST-179-5mg	AY-NH2 ¡ÚPAR4 Agonist Peptide¡Û	5mg	¾È²ñ	-20¡î	352017-71-1
	¡¡ ¡¡ ¡¡ Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2
¡¡	AST	AST-149-1g	(RS)-Baclofen ¡Ú(R,S)-4-Amino-3-(4-chlorophenyl)butanoic Acid¡Û¡ÚGABAB Agonist¡Û	1g	¾È²ñ	RT	1134-47-0
	¡¡ ¡¡ ¡¡ Selective GABAB receptor agonist. Antispasmodic.
¡¡	AST	AST-178-1mg	BAM (8-22) ¡ÚSNSR Agonist¡Û	1mg	¾È²ñ	-20¡î	412961-36-5
	¡¡ ¡¡ ¡¡ Endogenous peptide fragment that is a selective agonist for the sensory neuron specific receptor (EC50 values are 28 and 14 nM for SNSR3 and SNSR4 respectively). Inhibits development of morphine toler
¡¡	AST	AST-107-50mg	(+)-Bicuculline ¡Ú(S)-6-((S)-5,6,7,8-Tetrahydro-6-methyl-[1,3]dioxolo[4,5-g]isoquinolin-5-yl)isobenzofuro[4,5-d][1,3]dioxol-8(6H)-one¡Û¡ÚGABAA Antagonist.¡Û	50mg	¾È²ñ	+4¡î	485-49-4
	¡¡ ¡¡ ¡¡ GABAA antagonist.
¡¡	AST	AST-108-10mg	(-)-Bicuculline Methiodide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide¡Û¡ÚGABAA Antagonist¡Û	10mg	¾È²ñ	+4¡î	55950-07-7
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-108-50mg	(-)-Bicuculline Methiodide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide¡Û¡ÚGABAA Antagonist¡Û	50mg	¾È²ñ	+4¡î	55950-07-7
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-109-10mg	(-)-Bicuculline Methobromide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide¡Û¡ÚGABAA Antagonist¡Û	10mg	¾È²ñ	+4¡î	73604-30-5
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-109-50mg	(-)-Bicuculline Methobromide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide¡Û¡ÚGABAA Antagonist¡Û	50mg	¾È²ñ	+4¡î	73604-30-5
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-110-10mg	(-)-Bicuculline Methochloride ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride¡Û¡ÚGABAA Antagonist¡Û	10mg	¾È²ñ	+4¡î	53552-05-9
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-110-50mg	(-)-Bicuculline Methochloride ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride¡Û¡ÚGABAA Antagonist¡Û	50mg	¾È²ñ	+4¡î	53552-05-9
	¡¡ ¡¡ ¡¡ Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.
¡¡	AST	AST-299-5mg	Brefeldin A	5mg	¾È²ñ	-20¡î	20350-15-6
	¡¡ ¡¡ ¡¡ Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, ¦Â-COP and ADP-ribosylation factor (ARF) to Golgi m
¡¡	AST	AST-299-25mg	Brefeldin A	25mg	¾È²ñ	-20¡î	20350-15-6
	¡¡ ¡¡ ¡¡ Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, ¦Â-COP and ADP-ribosylation factor (ARF) to Golgi m
¡¡	AST	AST-240-1g	Caffeine ¡Ú1,3,7-Trimethylxanthine¡Û¡ÚPDE Inhibitor¡Û¡ÚAdenosine Antagonist¡Û	1g	¾È²ñ	RT	58-08-2
	¡¡ ¡¡ ¡¡ Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.
¡¡	AST	AST-240-5g	Caffeine ¡Ú1,3,7-Trimethylxanthine¡Û¡ÚPDE Inhibitor¡Û¡ÚAdenosine Antagonist¡Û	5g	¾È²ñ	RT	58-08-2
	¡¡ ¡¡ ¡¡ Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.
¡¡	AST	AST-115-50mg	Camptothecin ¡Ú(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione¡Û¡ÚDNA Topoisomerase Inhibitor¡Û	50mg	¾È²ñ	+4¡î	7689-03-4
	¡¡ ¡¡ ¡¡ Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.
¡¡	AST	AST-115-250mg	Camptothecin ¡Ú(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione¡Û¡ÚDNA Topoisomerase Inhibitor¡Û	250mg	¾È²ñ	+4¡î	7689-03-4
	¡¡ ¡¡ ¡¡ Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.
¡¡	AST	AST-025-10mg	Capsazepine ¡ÚVR1 Vanilloid Receptor Antagonist¡Û	10mg	¾È²ñ	+4¡î	138977-28-3
	¡¡ ¡¡ ¡¡ VR1 vanilloid receptor antagonist
¡¡	AST	AST-025-50mg	Capsazepine ¡ÚVR1 Vanilloid Receptor Antagonist¡Û	50mg	¾È²ñ	+4¡î	138977-28-3
	¡¡ ¡¡ ¡¡ VR1 vanilloid receptor antagonist
¡¡	AST	AST-209-1mg	CCK Octapeptide Sulfated	1mg	¾È²ñ	-20¡î	25126-32-3
	¡¡ ¡¡ ¡¡ Endogenous C-terminal octapeptide of CCK involved in the neurobiology of anxiety, depression, psychosis, cognition, nociception and feeding behavior.
¡¡	AST	AST-012-10mg	CGP 37157 ¡Ú7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one¡Û¡ÚNa+-Ca2+ Exchange Inhibitor¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger
¡¡	AST	AST-012-50mg	CGP 37157 ¡Ú7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one¡Û¡ÚNa+-Ca2+ Exchange Inhibitor¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger
¡¡	AST	AST-127-10mg	CGP 37849 ¡Ú(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û	10mg	¾È²ñ	+4¡î	127910-31-0
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.
¡¡	AST	AST-127-50mg	CGP 37849 ¡Ú(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û	50mg	¾È²ñ	+4¡î	127910-31-0
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.
¡¡	AST	AST-128-10mg	CGP 39551 ¡Ú(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û	10mg	¾È²ñ	+4¡î	127910-32-1
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.
¡¡	AST	AST-128-50mg	CGP 39551 ¡Ú(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û	50mg	¾È²ñ	+4¡î	127910-32-1
	¡¡ ¡¡ ¡¡ Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.
¡¡	AST	AST-269-10ug	Charybdotoxin	10ug	¾È²ñ	-20¡î	95751-30-7
	¡¡ ¡¡ ¡¡ Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC
¡¡	AST	AST-269-100ug	Charybdotoxin	100ug	¾È²ñ	-20¡î	95751-30-7
	¡¡ ¡¡ ¡¡ Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC
¡¡	AST	AST-037-10mg	2-Chloroadenosine ¡ÚAdenosine Agonist¡Û	10mg	¾È²ñ	+4¡î	146-77-0
	¡¡ ¡¡ ¡¡ Adenosine receptor agonist
¡¡	AST	AST-037-50mg	2-Chloroadenosine ¡ÚAdenosine Agonist¡Û	50mg	¾È²ñ	+4¡î	146-77-0
	¡¡ ¡¡ ¡¡ Adenosine receptor agonist
¡¡	AST	AST-037-250mg	2-Chloroadenosine ¡ÚAdenosine Agonist¡Û	250mg	¾È²ñ	+4¡î	146-77-0
	¡¡ ¡¡ ¡¡ Adenosine receptor agonist
¡¡	AST	AST-024-10mg	7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û	10mg	¾È²ñ	+4¡î	18000-24-3
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist
¡¡	AST	AST-024-50mg	7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û	50mg	¾È²ñ	+4¡î	18000-24-3
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist
¡¡	AST	AST-255-10mg	7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û, Na salt	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist. Water soluble form.
¡¡	AST	AST-255-50mg	7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û, Na salt	50mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist. Water soluble form.
¡¡	AST	AST-039-10mg	(RS)-CHPG ¡Ú(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid¡Û¡ÚSelective mGlu5 Agonist¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective mGlu5 receptor agonist
¡¡	AST	AST-039-50mg	(RS)-CHPG ¡Ú(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid¡Û¡ÚSelective mGlu5 Agonist¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective mGlu5 receptor agonist
¡¡	AST	AST-221-10mg	(RS)-CHPG, Na salt ¡Ú(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic £Ácid, Na salt¡Û¡ÚmGlu5 Agonist¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist
¡¡	AST	AST-221-50mg	(RS)-CHPG, Na salt ¡Ú(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic £Ácid, Na salt¡Û¡ÚmGlu5 Agonist¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist
·àʪ	AST	AST-133-25mg	Citalopram ¡Ú1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr¡Û¡Ú5HT Reuptake Inhibitor¡Û	25mg	¾È²ñ	RT	59729-32-7
	¡¡ ¡¡ ¡¡ Selective serotonin reuptake inhibitor. Antidepressant in vivo.
·àʪ	AST	AST-133-100mg	Citalopram ¡Ú1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr¡Û¡Ú5HT Reuptake Inhibitor¡Û	100mg	¾È²ñ	RT	59729-32-7
	¡¡ ¡¡ ¡¡ Selective serotonin reuptake inhibitor. Antidepressant in vivo.
¡¡	AST	AST-019-50mg	Clozapine ¡Ú(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û	50mg	¾È²ñ	+4¡î	5786-21-0
	¡¡ ¡¡ ¡¡ A typical antipsychotic compound.
¡¡	AST	AST-019-500mg	Clozapine ¡Ú(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û	500mg	¾È²ñ	+4¡î	5786-21-0
	¡¡ ¡¡ ¡¡ A typical antipsychotic compound.
·àʪ	AST	AST-017-10mg	CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û	10mg	¾È²ñ	+4¡î	115066-14-3
	¡¡ ¡¡ ¡¡ Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.
·àʪ	AST	AST-017-25mg	CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û	25mg	¾È²ñ	+4¡î	115066-14-3
	¡¡ ¡¡ ¡¡ Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.
·àʪ	AST	AST-017-50mg	CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û	50mg	¾È²ñ	+4¡î	115066-14-3
	¡¡ ¡¡ ¡¡ Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.
·àʪ	AST	AST-044-10mg	CNQX, 2Na salt ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.
·àʪ	AST	AST-044-50mg	CNQX, 2Na salt ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.
¡¡	AST	AST-215	¦Ø-Conotoxin GVIA - - - only Information		¾È²ñ	-20¡î	106375-28-4
	¡¡ ¡¡ ¡¡ Synthetic toxin originally isolated from Conus geographus. Specific blocker of Cav2.2 (N-type) Ca2+ channels. Binds to the Cav2.2¦Á1 subunit (¦Á1B) and its action is only partially reversible.
¡¡	AST	AST-216	¦Ø-Conotoxin MVIIA - - - only Information		¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ Synthetic peptidyl toxin originally isolated from Conus magus snail venom. Specifically blocks Cav2.2 (¦Á1B, N-type) channels.
¡¡	AST	AST-211	¦Ø-Conotoxin MVIIC - - - only Information		¾È²ñ	-20¡î	147794-23-8
	¡¡ ¡¡ ¡¡ Blocker of voltage-gated Ca2+ channels (P and Q)
¡¡	AST	AST-060-10mg	CPCCOEt ¡Ú(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate¡Û	10mg	¾È²ñ	+4¡î	179067-99-3
	¡¡ ¡¡ ¡¡ Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist
¡¡	AST	AST-060-50mg	CPCCOEt ¡Ú(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate¡Û	50mg	¾È²ñ	+4¡î	179067-99-3
	¡¡ ¡¡ ¡¡ Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist
¡¡	AST	AST-159-10mg	(R)-CPP ¡Ú(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid¡Û	10mg	¾È²ñ	RT	126453-07-4
	¡¡ ¡¡ ¡¡ Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 ¦ÌM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.
¡¡	AST	AST-159-50mg	(R)-CPP ¡Ú(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid¡Û	50mg	¾È²ñ	RT	126453-07-4
	¡¡ ¡¡ ¡¡ Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 ¦ÌM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.
·àʪ	AST	AST-093-100mg	Cycloheximide ¡Ú3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide¡Û¡ÚProtein Synthesis Inhibitor¡Û	100mg	¾È²ñ	+4¡î	66-81-9
	¡¡ ¡¡ ¡¡ Protein synthesis inhibitor. Antifungal antibiotic.
·àʪ	AST	AST-093-1g	Cycloheximide ¡Ú3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide¡Û¡ÚProtein Synthesis Inhibitor¡Û	1g	¾È²ñ	+4¡î	66-81-9
	¡¡ ¡¡ ¡¡ Protein synthesis inhibitor. Antifungal antibiotic.
¡¡	AST	AST-300-10mg	Cyclopiazonic Acid from Penicillium grisefulvum	10mg	¾È²ñ	-20¡î	18172-33-3
	¡¡ ¡¡ ¡¡ Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.
¡¡	AST	AST-300-50mg	Cyclopiazonic Acid from Penicillium grisefulvum	50mg	¾È²ñ	-20¡î	18172-33-3
	¡¡ ¡¡ ¡¡ Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.
¡¡	AST	AST-121-50mg	D-Cycloserine ¡Ú(R)-4-Aminoisoxazolidin-3-one¡Û¡ÚNMDA Glycine site Agonist¡Û	50mg	¾È²ñ	-20¡î	68-41-7
	¡¡ ¡¡ ¡¡ Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.
¡¡	AST	AST-121-250mg	D-Cycloserine ¡Ú(R)-4-Aminoisoxazolidin-3-one¡Û¡ÚNMDA Glycine site Agonist¡Û	250mg	¾È²ñ	-20¡î	68-41-7
	¡¡ ¡¡ ¡¡ Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.
¡¡	AST	AST-114-25mg	Cyclosporin A ¡ÚPP2B Inhibitor¡Û	25mg	¾È²ñ	-20¡î	59865-13-3
	¡¡ ¡¡ ¡¡ Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).
¡¡	AST	AST-114-100mg	Cyclosporin A ¡ÚPP2B Inhibitor¡Û	100mg	¾È²ñ	-20¡î	59865-13-3
	¡¡ ¡¡ ¡¡ Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).
¡¡	AST	AST-114-250mg	Cyclosporin A ¡ÚPP2B Inhibitor¡Û	250mg	¾È²ñ	-20¡î	59865-13-3
	¡¡ ¡¡ ¡¡ Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).
¡¡	AST	AST-061-10mg	Cyclothiazide ¡Ú6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide¡Û	10mg	¾È²ñ	+4¡î	2259-96-3
	¡¡ ¡¡ ¡¡ Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.
¡¡	AST	AST-061-50mg	Cyclothiazide ¡Ú6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide¡Û	50mg	¾È²ñ	+4¡î	2259-96-3
	¡¡ ¡¡ ¡¡ Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.
¡¡	AST	AST-220-10mg	D4476 ¡Ú4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide¡Û¡ÚCK1 Inhibitor¡Û	10mg	¾È²ñ	+4¡î	301836-43-1
	¡¡ ¡¡ ¡¡ Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 ¦ÌM for CK1, ALK5, PKD1 and p38¦ÁMAPK respectively. Displays selectivity over many other protein kin
¡¡	AST	AST-220-50mg	D4476 ¡Ú4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide¡Û¡ÚCK1 Inhibitor¡Û	50mg	¾È²ñ	+4¡î	301836-43-1
	¡¡ ¡¡ ¡¡ Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 ¦ÌM for CK1, ALK5, PKD1 and p38¦ÁMAPK respectively. Displays selectivity over many other protein kin
¡¡	AST	AST-144-25mg	4-DAMP ¡Ú4-Diphenylacetoxy-N-methylpiperidine Methiodide¡Û¡ÚMuscarinic Receptor Antagonist¡Û	25mg	¾È²ñ	RT	1952-15-4
	¡¡ ¡¡ ¡¡ Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.
¡¡	AST	AST-144-100mg	4-DAMP ¡Ú4-Diphenylacetoxy-N-methylpiperidine Methiodide¡Û¡ÚMuscarinic Receptor Antagonist¡Û	100mg	¾È²ñ	RT	1952-15-4
	¡¡ ¡¡ ¡¡ Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.
¡¡	AST	AST-006-10mg	(S)-3,4-DCPG ¡ÚUBP1109¡Û¡Ú(S)-3,4-Dicarboxyphenylglycine¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.
¡¡	AST	AST-006-50mg	(S)-3,4-DCPG ¡ÚUBP1109¡Û¡Ú(S)-3,4-Dicarboxyphenylglycine¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.
¡¡	AST	AST-026-10mg	N-Desmethylclozapine ¡ÚNormethylclozapine¡Û¡Ú8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û	10mg	¾È²ñ	+4¡î	6104-71-8
	¡¡ ¡¡ ¡¡ Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist
¡¡	AST	AST-026-50mg	N-Desmethylclozapine ¡ÚNormethylclozapine¡Û¡Ú8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û	50mg	¾È²ñ	+4¡î	6104-71-8
	¡¡ ¡¡ ¡¡ Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist
¡¡	AST	AST-016-10mg	Desmethyl YM298198 ¡Ú6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Derivative of mGlu1 antagonist YM298198 (#Asc-015)
¡¡	AST	AST-016-50mg	Desmethyl YM298198 ¡Ú6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Derivative of mGlu1 antagonist YM298198 (#Asc-015)
¡¡	AST	AST--307-50mg	¦Ã-DGG ¡Ú(R)-4-(Carboxymethylcarbamoyl)-2-aminobutanoic Acid¡Û	50mg	¾È²ñ	+4¡î	6729-55-1
	¡¡ ¡¡ ¡¡ Ionotropic glutamate receptor antagonist that has been used as a rapidly dissociating, low affinity competitive antagonist at AMPA receptors.
¡¡	AST	AST-020-10mg	(R,S)-3,5-DHPG ¡Ú2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid¡Û	10mg	¾È²ñ	+4¡î	19641-83-9
	¡¡ ¡¡ ¡¡ Selective group I mGlu receptor agonist
¡¡	AST	AST-020-50mg	(R,S)-3,5-DHPG ¡Ú2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid¡Û	50mg	¾È²ñ	+4¡î	19641-83-9
	¡¡ ¡¡ ¡¡ Selective group I mGlu receptor agonist
¡¡	AST	AST-007-5mg	(S)-3,5-DHPG ¡Ú(S)-3,5-Dihydroxyphenylglycine¡Û	5mg	¾È²ñ	+4¡î	162870-29-3
	¡¡ ¡¡ ¡¡ Selective group I mGlu agonist.
¡¡	AST	AST-007-10mg	(S)-3,5-DHPG ¡Ú(S)-3,5-Dihydroxyphenylglycine¡Û	10mg	¾È²ñ	+4¡î	162870-29-3
	¡¡ ¡¡ ¡¡ Selective group I mGlu agonist.
¡¡	AST	AST-266-100mg	Diazoxide ¡Ú7-Chloro-3-methyl-2H-1,2,4-benzothiadiazine 1,1-Dioxide¡Û	100mg	¾È²ñ	RT	364-98-7
	¡¡ ¡¡ ¡¡ Selective KIR6.x (ATP-sensitive K+ channel) activator; antihypertensive.
¡¡	AST	AST-023-10mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	131123-76-7
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist.
¡¡	AST	AST-023-50mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	131123-76-7
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist.
¡¡	AST	AST-023-100mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û	100mg	¾È²ñ	+4¡î	131123-76-7
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist.
¡¡	AST	AST-254-10mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist. Water soluble form.
¡¡	AST	AST-254-50mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt	50mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist. Water soluble form.
¡¡	AST	AST-254-100mg	5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt	100mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent NMDA receptor glycine site antagonist. Water soluble form.
¡¡	AST	AST-066-10mg	Dihydrokainic Acid ¡ÚDihydrokainate¡Û¡Ú(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	52497-36-6
	¡¡ ¡¡ ¡¡ Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 ¦ÌM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).
¡¡	AST	AST-066-50mg	Dihydrokainic Acid ¡ÚDihydrokainate¡Û¡Ú(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	52497-36-6
	¡¡ ¡¡ ¡¡ Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 ¦ÌM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).
¡¡	AST	AST-260-1g	Diltiazem	1g	¾È²ñ	RT	33286-22-5
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel antagonist. Coronary vasodilator.
¡¡	AST	AST-018-10mg	DNQX ¡Ú6,7-Dinitroquinoxaline-2,3-dione¡Û	10mg	¾È²ñ	+4¡î	2379-57-9
	¡¡ ¡¡ ¡¡ AMPA / Kainate antagonist
¡¡	AST	AST-018-50mg	DNQX ¡Ú6,7-Dinitroquinoxaline-2,3-dione¡Û	50mg	¾È²ñ	+4¡î	2379-57-9
	¡¡ ¡¡ ¡¡ AMPA / Kainate antagonist
¡¡	AST	AST-169-10mg	DNQX, 2Na salt ¡Ú6,7-Dinitroquinoxaline-2,3-dione, 2Na salt¡Û¡ÚAMPA / Kainate Antagonist¡Û	10mg	¾È²ñ	+4¡î	2379-57-9
	¡¡ ¡¡ ¡¡ Water soluble, AMPA / kainate antagonist
¡¡	AST	AST-169-50mg	DNQX, 2Na salt ¡Ú6,7-Dinitroquinoxaline-2,3-dione, 2Na salt¡Û¡ÚAMPA / Kainate Antagonist¡Û	50mg	¾È²ñ	+4¡î	2379-57-9
	¡¡ ¡¡ ¡¡ Water soluble, AMPA / kainate antagonist
·àʪ	AST	AST-166-10mg	DPN ¡Ú2,3-Bis(4-hydroxyphenyl)propionitrile¡Û¡ÚPotent, selective ER¦Â Agonist¡Û	10mg	¾È²ñ	-20¡î	1428-67-7
	¡¡ ¡¡ ¡¡ Potent, selective ER¦Â agonist (EC50 values are 0.85 and 66 nM for ER¦Â and ER¦Á respectively). Cardioprotective and neuroprotective in vivo.
·àʪ	AST	AST-166-50mg	DPN ¡Ú2,3-Bis(4-hydroxyphenyl)propionitrile¡Û¡ÚPotent, selective ER¦Â Agonist¡Û	50mg	¾È²ñ	-20¡î	1428-67-7
	¡¡ ¡¡ ¡¡ Potent, selective ER¦Â agonist (EC50 values are 0.85 and 66 nM for ER¦Â and ER¦Á respectively). Cardioprotective and neuroprotective in vivo.
¡¡	AST	AST-192-10mg	Dynasore ¡Ú3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate¡Û¡ÚCell permeable Dynamin Inhibitor¡Û	10mg	¾È²ñ	-20¡î	304448-55-3
	¡¡ ¡¡ ¡¡ Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.
¡¡	AST	AST-192-50mg	Dynasore ¡Ú3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate¡Û¡ÚCell permeable Dynamin Inhibitor¡Û	50mg	¾È²ñ	-20¡î	304448-55-3
	¡¡ ¡¡ ¡¡ Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.
¡¡	AST	AST-258-10mg	1-EBIO ¡Ú1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one¡Û	10mg	¾È²ñ	RT	10045-45-1
	¡¡ ¡¡ ¡¡ Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.
¡¡	AST	AST-258-50mg	1-EBIO ¡Ú1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one¡Û	50mg	¾È²ñ	RT	10045-45-1
	¡¡ ¡¡ ¡¡ Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.
¡¡	AST	AST-158-10mg	E-4031, 2HCl ¡ÚN-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide¡Û¡ÚHERG K+ Channel Blocker¡Û	10mg	¾È²ñ	+4¡î	113559-13-0
	¡¡ ¡¡ ¡¡ Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl
¡¡	AST	AST-158-50mg	E-4031, 2HCl ¡ÚN-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide¡Û¡ÚHERG K+ Channel Blocker¡Û	50mg	¾È²ñ	+4¡î	113559-13-0
	¡¡ ¡¡ ¡¡ Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl
¡¡	AST	AST-328-10mg	EMD 386088, HCl ¡Ú5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl¡Û	10mg	¾È²ñ	RT	54635-62-0
	¡¡ ¡¡ ¡¡ Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D
¡¡	AST	AST-328-50mg	EMD 386088, HCl ¡Ú5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl¡Û	50mg	¾È²ñ	RT	54635-62-0
	¡¡ ¡¡ ¡¡ Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D
¡¡	AST	AST-311-10mg	Etomidate ¡ÚEthyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate¡Û	10mg	¾È²ñ	RT	33125-97-2
	¡¡ ¡¡ ¡¡ Agonist at GABAA receptors containing ¦Â3 subunits. Anaesthetic and amnesic properties.
¡¡	AST	AST-311-50mg	Etomidate ¡ÚEthyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate¡Û	50mg	¾È²ñ	RT	33125-97-2
	¡¡ ¡¡ ¡¡ Agonist at GABAA receptors containing ¦Â3 subunits. Anaesthetic and amnesic properties.
¡¡	AST	AST-227-25mg	Etoposide ¡ÚTopoisomerase II Inhibitor¡Û	25mg	¾È²ñ	RT	33419-42-0
	¡¡ ¡¡ ¡¡ Topoisomerase II inhibitor. Anticancer agent.
¡¡	AST	AST-227-100mg	Etoposide ¡ÚTopoisomerase II Inhibitor¡Û	100mg	¾È²ñ	RT	33419-42-0
	¡¡ ¡¡ ¡¡ Topoisomerase II inhibitor. Anticancer agent.
¡¡	AST	AST-214-0.5mg	Exendin-4	0.5mg	¾È²ñ	-20¡î	141758-74-9
	¡¡ ¡¡ ¡¡ High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
¡¡	AST	AST-214-1mg	Exendin-4	1mg	¾È²ñ	-20¡î	141758-74-9
	¡¡ ¡¡ ¡¡ High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
¡¡	AST	AST-292-10mg	Exo-1 ¡ÚMethyl 2-(4-Fluorobenzamido)benzoate¡Û	10mg	¾È²ñ	RT	461681-88-9
	¡¡ ¡¡ ¡¡ Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 ¦ÌM. Rapidly releases Arf1 from Golgi
¡¡	AST	AST-292-50mg	Exo-1 ¡ÚMethyl 2-(4-Fluorobenzamido)benzoate¡Û	50mg	¾È²ñ	RT	461681-88-9
	¡¡ ¡¡ ¡¡ Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 ¦ÌM. Rapidly releases Arf1 from Golgi
·àʪ	AST	AST-081-10mg	FCCP ¡ÚCarbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone¡Û	10mg	¾È²ñ	+4¡î	370-86-5
	¡¡ ¡¡ ¡¡ A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.
·àʪ	AST	AST-081-50mg	FCCP ¡ÚCarbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone¡Û	50mg	¾È²ñ	+4¡î	370-86-5
	¡¡ ¡¡ ¡¡ A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.
¡¡	AST	AST-034-10mg	Fenobam ¡Ú1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea¡Û	10mg	¾È²ñ	+4¡î	57653-26-6
	¡¡ ¡¡ ¡¡ Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie
¡¡	AST	AST-034-50mg	Fenobam ¡Ú1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea¡Û	50mg	¾È²ñ	+4¡î	57653-26-6
	¡¡ ¡¡ ¡¡ Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie
¡¡	AST	AST-223-10mg	FK506	10mg	¾È²ñ	-20¡î	109581-93-3
	¡¡ ¡¡ ¡¡ Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.
¡¡	AST	AST-223-50mg	FK506	50mg	¾È²ñ	-20¡î	109581-93-3
	¡¡ ¡¡ ¡¡ Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.
¡¡	AST	AST-242-10mg	Flumazenil ¡Ú8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester¡Û¡ÚBenzodiazepine Antagonist¡Û	10mg	¾È²ñ	+4¡î	78755-81-4
	¡¡ ¡¡ ¡¡ Selective non-competitive benzodiazepine antagonist with low affinity for ¦Á4- and ¦Á6-subunits
¡¡	AST	AST-242-50mg	Flumazenil ¡Ú8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester¡Û¡ÚBenzodiazepine Antagonist¡Û	50mg	¾È²ñ	+4¡î	78755-81-4
	¡¡ ¡¡ ¡¡ Selective non-competitive benzodiazepine antagonist with low affinity for ¦Á4- and ¦Á6-subunits
¡¡	AST	AST-036-10mg	(S)-5-Fluorowillardiine ¡ÚS)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	10mg	¾È²ñ	+4¡î	140187-23-1
	¡¡ ¡¡ ¡¡ Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.
¡¡	AST	AST-036-50mg	(S)-5-Fluorowillardiine ¡ÚS)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	50mg	¾È²ñ	+4¡î	140187-23-1
	¡¡ ¡¡ ¡¡ Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.
¡¡	AST	AST-077-10mg	Fluoxetine, HCl ¡ÚN-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl¡Û	10mg	¾È²ñ	+4¡î	56296-78-7
	¡¡ ¡¡ ¡¡ Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove
¡¡	AST	AST-077-50mg	Fluoxetine, HCl ¡ÚN-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl¡Û	50mg	¾È²ñ	+4¡î	56296-78-7
	¡¡ ¡¡ ¡¡ Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove
¡¡	AST	AST-058-10mg	Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û	10mg	¾È²ñ	-20¡î	66575-29-9
	¡¡ ¡¡ ¡¡ Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti
¡¡	AST	AST-058-50mg	Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û	50mg	¾È²ñ	-20¡î	66575-29-9
	¡¡ ¡¡ ¡¡ Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti
¡¡	AST	AST-058-100mg	Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û	100mg	¾È²ñ	-20¡î	66575-29-9
	¡¡ ¡¡ ¡¡ Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti
¡¡	AST	AST-219-10mg	Gabapentin ¡Ú2-[1-(Aminomethyl)cyclohexyl]acetic Acid¡Û¡Ú¦Á2¦Ä Ligand¡Û	10mg	¾È²ñ	+4¡î	60142-96-3
	¡¡ ¡¡ ¡¡ Interacts with the ¦Á2¦Ä subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.
¡¡	AST	AST-219-50mg	Gabapentin ¡Ú2-[1-(Aminomethyl)cyclohexyl]acetic Acid¡Û¡Ú¦Á2¦Ä Ligand¡Û	50mg	¾È²ñ	+4¡î	60142-96-3
	¡¡ ¡¡ ¡¡ Interacts with the ¦Á2¦Ä subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.
¡¡	AST	AST-172-0.5mg	Galanin (1-16) (porcine, rat)	0.5mg	¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI
¡¡	AST	AST-172-1mg	Galanin (1-16) (porcine, rat)	1mg	¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI
¡¡	AST	AST-112-10mg	Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û	10mg	¾È²ñ	-20¡î	446-72-0
	¡¡ ¡¡ ¡¡ Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.
¡¡	AST	AST-112-50mg	Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û	50mg	¾È²ñ	-20¡î	446-72-0
	¡¡ ¡¡ ¡¡ Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.
¡¡	AST	AST-112-100mg	Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û	100mg	¾È²ñ	-20¡î	446-72-0
	¡¡ ¡¡ ¡¡ Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.
¡¡	AST	AST-230-1mg	Ghrelin (human)	1mg	¾È²ñ	-20¡î	258279-04-8
	¡¡ ¡¡ ¡¡ Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se
¡¡	AST	AST-231-1mg	Ghrelin (rat)	1mg	¾È²ñ	-20¡î	258279-04-8
	¡¡ ¡¡ ¡¡ Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se
¡¡	AST	AST-267-100mg	Glibenclamide ¡ÚN-p-[2-(5-Chloro-2-methoxybenzamido)ethyl]benzenesulfonyl-N'-cyclohexylurea¡Û	100mg	¾È²ñ	RT	10238-21-8
	¡¡ ¡¡ ¡¡ Selective blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.
¡¡	AST	AST-049-1g	L-Glutamate ¡Ú(S)-2-Aminopentanedioic Acid¡Û	1g	¾È²ñ	+4¡î	56-86-0
	¡¡ ¡¡ ¡¡ Excitatory neurotransmitter.
¡¡	AST	AST-049-2.5g	L-Glutamate ¡Ú(S)-2-Aminopentanedioic Acid¡Û	2.5g	¾È²ñ	+4¡î	56-86-0
	¡¡ ¡¡ ¡¡ Excitatory neurotransmitter.
¡¡	AST	AST-050-100mg	Glycine ¡Ú2-Aminoacetic Acid¡Û	100mg	¾È²ñ	+4¡î	56-40-6
	¡¡ ¡¡ ¡¡ Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.
¡¡	AST	AST-050-1g	Glycine ¡Ú2-Aminoacetic Acid¡Û	1g	¾È²ñ	+4¡î	56-40-6
	¡¡ ¡¡ ¡¡ Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.
¡¡	AST	AST-125-50mg	Granisetron ¡Ú1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl¡Û¡Ú5HT3 Antagonist¡Û	50mg	¾È²ñ	+4¡î	107007-99-8
	¡¡ ¡¡ ¡¡ Highly selective 5HT3 antagonist. Anti-emetic.
¡¡	AST	AST-125-250mg	Granisetron ¡Ú1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl¡Û¡Ú5HT3 Antagonist¡Û	250mg	¾È²ñ	+4¡î	107007-99-8
	¡¡ ¡¡ ¡¡ Highly selective 5HT3 antagonist. Anti-emetic.
¡¡	AST	AST-306-10mg	HA-1077 ¡Ú1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl¡Û	10mg	¾È²ñ	RT	103745-39-7
	¡¡ ¡¡ ¡¡ ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 ¦ÌM, 4 ¦ÌM and 5 ¦ÌM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi
¡¡	AST	AST-306-50mg	HA-1077 ¡Ú1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl¡Û	50mg	¾È²ñ	RT	103745-39-7
	¡¡ ¡¡ ¡¡ ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 ¦ÌM, 4 ¦ÌM and 5 ¦ÌM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi
¡¡	AST	AST-080-100mg	Haloperidol ¡Ú4-[4-(4-Chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one¡Û	100mg	¾È²ñ	+4¡î	52-86-3
	¡¡ ¡¡ ¡¡ Dopamine antagonist with selectivity for D2-like receptors (Ki values are 1.2, 7, 2.3, 80 and 100 nM for D2, D3, D4, D1 and D5 receptors respectively). Also NMDA antagonist.
¡¡	AST	AST-225-100mg	Harmine ¡Ú7-Methoxy-1-methyl-9H-pyrido[3,4-b]indole¡Û	100mg	¾È²ñ	RT	442-51-3
	¡¡ ¡¡ ¡¡ Potent and selective inhibitor of DYRK1A (dual specificity tyrosine-phosphorylated and -regulated kinase). IC50 values are 0.08, 0.9, 0.8, 4.3 and 1.5 ¦ÌM for DYRK1A, DYRK2, DYRK3, PIM3 and CK1 respec
¡¡	AST	AST-147-1mg	Herkinorin ¡ÚNon-internalising ¦Ì Opioid Agonist¡Û	1mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective ¦Ì opioid receptor agonist derived from the plant product, salvinorin A (Asc-084). Does not promote the recruitment of beta-arrestin-2 or lead to receptor internalization.
¡¡	AST	AST-041-1mg	Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û	1mg	¾È²ñ	-20¡î	2552-55-8
	¡¡ ¡¡ ¡¡ Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.
¡¡	AST	AST-041-5mg	Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û	5mg	¾È²ñ	-20¡î	2552-55-8
	¡¡ ¡¡ ¡¡ Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.
¡¡	AST	AST-041-25mg	Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û	25mg	¾È²ñ	-20¡î	2552-55-8
	¡¡ ¡¡ ¡¡ Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.
¡¡	AST	AST-131-10mg	ICI 182,780 ¡Ú(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol¡Û¡ÚEstrogen receptor antagonist	10mg	¾È²ñ	RT	129453-61-8
	¡¡ ¡¡ ¡¡ Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.
¡¡	AST	AST-131-50mg	ICI 182,780 ¡Ú(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol¡Û¡ÚEstrogen receptor antagonist	50mg	¾È²ñ	RT	129453-61-8
	¡¡ ¡¡ ¡¡ Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.
¡¡	AST	AST-111-10mg	Ifenprodil ¡Ú4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate¡Û¡ÚNR2B-preferring NMDA Antagonist¡Û	10mg	¾È²ñ	+4¡î	23210-58-4
	¡¡ ¡¡ ¡¡ Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 ¦ÌM at NR1/NR2B and >30 ¦ÌM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors
¡¡	AST	AST-111-50mg	Ifenprodil ¡Ú4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate¡Û¡ÚNR2B-preferring NMDA Antagonist¡Û	50mg	¾È²ñ	+4¡î	23210-58-4
	¡¡ ¡¡ ¡¡ Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 ¦ÌM at NR1/NR2B and >30 ¦ÌM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors
¡¡	AST	AST-222-10mg	(S)-5-Iodowillardiine ¡Ú(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚGluR5 Kainate Agonist¡Û	10mg	¾È²ñ	RT	140187-25-3
	¡¡ ¡¡ ¡¡ Selective GluR5 Kainate receptor agonist (EC50 = 83 ¦ÌM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.
¡¡	AST	AST-222-50mg	(S)-5-Iodowillardiine ¡Ú(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚGluR5 Kainate Agonist¡Û	50mg	¾È²ñ	RT	140187-25-3
	¡¡ ¡¡ ¡¡ Selective GluR5 Kainate receptor agonist (EC50 = 83 ¦ÌM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.
¡¡	AST	AST-116-1mg	Ionomycin Ca2+ Salt ¡ÚCalcium Ionophore¡Û	1mg	¾È²ñ	+4¡î	56092-82-1
	¡¡ ¡¡ ¡¡ Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.
¡¡	AST	AST-116-5mg	Ionomycin Ca2+ Salt ¡ÚCalcium Ionophore¡Û	5mg	¾È²ñ	+4¡î	56092-82-1
	¡¡ ¡¡ ¡¡ Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.
¡¡	AST	AST-142-10mg	Isradipine ¡Ú4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	10mg	¾È²ñ	+4¡î	75695-93-1
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker.
¡¡	AST	AST-142-50mg	Isradipine ¡Ú4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	50mg	¾È²ñ	+4¡î	75695-93-1
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker.
¡¡	AST	AST-191-10mg	JNJ 10191584 Mmaleate ¡Ú(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate¡Û¡ÚSelective H4 Antagonist¡Û	10mg	¾È²ñ	RT	869497-75-6
	¡¡ ¡¡ ¡¡ Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.
¡¡	AST	AST-191-50mg	JNJ 10191584 Mmaleate ¡Ú(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate¡Û¡ÚSelective H4 Antagonist¡Û	50mg	¾È²ñ	RT	869497-75-6
	¡¡ ¡¡ ¡¡ Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.
¡¡	AST	AST-100-10mg	Kainic Acid ¡Ú(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	58002-62-3
	¡¡ ¡¡ ¡¡ Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.
¡¡	AST	AST-100-50mg	Kainic Acid ¡Ú(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	58002-62-3
	¡¡ ¡¡ ¡¡ Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.
¡¡	AST	AST-284-10mg	KB-R7943 ¡Ú2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate¡Û	10mg	¾È²ñ	RT	182004-65-5
	¡¡ ¡¡ ¡¡ Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 ¦ÌM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 ¦ÌM, 0
¡¡	AST	AST-284-50mg	KB-R7943 ¡Ú2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate¡Û	50mg	¾È²ñ	RT	182004-65-5
	¡¡ ¡¡ ¡¡ Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 ¦ÌM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 ¦ÌM, 0
¡¡	AST	AST-132-50mg	Ketanserin Tartrate ¡Ú3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt¡Û¡ÚSelective 5HT2 Antagonist¡Û	50mg	¾È²ñ	RT	83846-83-7
	¡¡ ¡¡ ¡¡ 5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1D¦Á over 5HT1¦Â, and affinity at ¦Á1 adrenoceptors. Antihypertensive in vivo.
¡¡	AST	AST-132-250mg	Ketanserin Tartrate ¡Ú3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt¡Û¡ÚSelective 5HT2 Antagonist¡Û	250mg	¾È²ñ	RT	83846-83-7
	¡¡ ¡¡ ¡¡ 5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1D¦Á over 5HT1¦Â, and affinity at ¦Á1 adrenoceptors. Antihypertensive in vivo.
¡¡	AST	AST-181-1mg	Kisspeptin-13 (4-13) ¡ÚAXOR12 Agonist¡Û (human)	1mg	¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ Agonist of AXOR12 receptor (pEC50 = 9.30). Peptide derived from KiSS-1. Recently shown to be a potent vasoconstrictor in rat aorta (pD2 = 11.64) Amino Acids Sequence:YNWNSFGLRF-NH2
¡¡	AST	AST-064-1g	Kynurenic Acid ¡Ú4-Hydroxyquinoline-2-carboxylic Acid¡Û¡ÚEndogenous Ionotropic /Nicotinic Antagonist¡Û	1g	¾È²ñ	RT	492-27-3
	¡¡ ¡¡ ¡¡ Endogenous antagonist at ionotropic, Glycine ¦Â and ¦Á7 nicotinic receptors. Neuroprotective in vivo.
¡¡	AST	AST-256-1g	Kynurenic Acid ¡Ú4-Hydroxyquinoline-2-carboxylic Acid¡Û¡ÚEndogenous Ionotropic /Nicotinic Antagonist¡Û, Na salt	1g	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Endogenous antagonist at ionotropic, glycine and ¦Á7 nicotinic receptors. Neuroprotective in vivo. Water soluble form.
¡¡	AST	AST-188-1mg	Locustatachykinin I ¡ÚInsect Tachykinin-related Peptide¡Û	1mg	¾È²ñ	-20¡î	126985-97-5
	¡¡ ¡¡ ¡¡ Insect tachykinin-related peptide isolated from Locusta migratoria. Exhibits sequence homology with vertebrate tachykinins.
¡¡	AST	AST-184-5mg	Luteinizing Hormone Releasing Hormone	5mg	¾È²ñ	-20¡î	33515-09-2
	¡¡ ¡¡ ¡¡ Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2
¡¡	AST	AST-184-10mg	Luteinizing Hormone Releasing Hormone	10mg	¾È²ñ	-20¡î	33515-09-2
	¡¡ ¡¡ ¡¡ Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2
¡¡	AST	AST-243-5mg	LY 294002 ¡Ú2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one¡Û¡ÚPI-3 Kinase Inhibitor¡Û	5mg	¾È²ñ	+4¡î	154447-36-6
	¡¡ ¡¡ ¡¡ A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 ¦ÌM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >
¡¡	AST	AST-243-25mg	LY 294002 ¡Ú2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one¡Û¡ÚPI-3 Kinase Inhibitor¡Û	25mg	¾È²ñ	+4¡î	154447-36-6
	¡¡ ¡¡ ¡¡ A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 ¦ÌM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >
¡¡	AST	AST-199-1mg	LY 341495 ¡Ú(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid¡Û	1mg	¾È²ñ	RT	201943-63-7
	¡¡ ¡¡ ¡¡ Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a
¡¡	AST	AST-199-5mg	LY 341495 ¡Ú(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid¡Û	5mg	¾È²ñ	RT	201943-63-7
	¡¡ ¡¡ ¡¡ Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a
¡¡	AST	AST-173-10mg	LY 354740 ¡Ú(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto
¡¡	AST	AST-173-50mg	LY 354740 ¡Ú(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto
¡¡	AST	AST-196-10mg	LY 379268 ¡Ú(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	191471-52-0
	¡¡ ¡¡ ¡¡ Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto
¡¡	AST	AST-196-50mg	LY 379268 ¡Ú(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	191471-52-0
	¡¡ ¡¡ ¡¡ Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto
¡¡	AST	AST-201-10mg	LY 456236 ¡Ú(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.
¡¡	AST	AST-201-50mg	LY 456236 ¡Ú(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.
¡¡	AST	AST-252-10mg	(RS)-MCGP, Na salt ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine, Na salt¡Û	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.
¡¡	AST	AST-252-50mg	(RS)-MCGP, Na salt ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine, Na salt¡Û	50mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.
¡¡	AST	AST-033-10mg	(R,S)-MCPG ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine¡Û	10mg	¾È²ñ	+4¡î	146669-29-6
	¡¡ ¡¡ ¡¡ Group I / group II metabotropic glutamate receptor antagonist.
¡¡	AST	AST-033-50mg	(R,S)-MCPG ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine¡Û	50mg	¾È²ñ	+4¡î	146669-29-6
	¡¡ ¡¡ ¡¡ Group I / group II metabotropic glutamate receptor antagonist.
¡¡	AST	AST-059-10mg	(S)-MCPG ¡Ú(S)-¦Á-Methyl-4-carboxyphenylglycine¡Û	10mg	¾È²ñ	+4¡î	150145-89-4
	¡¡ ¡¡ ¡¡ Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.
¡¡	AST	AST-059-50mg	(S)-MCPG ¡Ú(S)-¦Á-Methyl-4-carboxyphenylglycine¡Û	50mg	¾È²ñ	+4¡î	150145-89-4
	¡¡ ¡¡ ¡¡ Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.
¡¡	AST	AST-249-50mg	Memantine ¡Ú3,5-Dimethyl-1-adamantanamine¡Û, HCl	50mg	¾È²ñ	RT	41100-52-1
	¡¡ ¡¡ ¡¡ Antagonist at the NMDA receptor. Acts as a fast, voltage-dependent, open channel NMDA receptor blocker. Used in the clinic to treat Alzheimer's Disease. Cognitive enhancer and anxiolytic in vivo.
¡¡	AST	AST-053	(R)-(-)-¦Á-Methylhistamine, 2HBr ¡Ú(R)-1-(1H-Imidazol-4-yl)propan-2-amine¡Û - - - Discontinued		¾È²ñ	+4¡î	75614-87-8
	¡¡ ¡¡ ¡¡ Potent, selective H3 histamine receptor agonist which crosses the blood-brain barrier; inhibits histamine synthesis and release.
¡¡	AST	AST-119-10mg	N-Methyllidocaine Iodide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide¡Û¡ÚAnti-arrthymic¡Û	10mg	¾È²ñ	+4¡î	29199-61-9
	¡¡ ¡¡ ¡¡ Anti-arrhythmic. Enhances phosphatidyl biosynthesis.
¡¡	AST	AST-119-50mg	N-Methyllidocaine Iodide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide¡Û¡ÚAnti-arrthymic¡Û	50mg	¾È²ñ	+4¡î	29199-61-9
	¡¡ ¡¡ ¡¡ Anti-arrhythmic. Enhances phosphatidyl biosynthesis.
¡¡	AST	AST-072-5mg	Methyllycaconitine Citrate ¡Ú[1¦Á,4(S),6¦Â,14¦Á,16¦Â]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate¡Û¡Ú¦Á7-Nicotinic Receptor	5mg	¾È²ñ	-20¡î	21019-30-7
	¡¡ ¡¡ ¡¡ Potent, selective antagonist at ¦Á7-containing nicotinic receptors.
¡¡	AST	AST-072-25mg	Methyllycaconitine Citrate ¡Ú[1¦Á,4(S),6¦Â,14¦Á,16¦Â]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate¡Û¡Ú¦Á7-Nicotinic Receptor	25mg	¾È²ñ	-20¡î	21019-30-7
	¡¡ ¡¡ ¡¡ Potent, selective antagonist at ¦Á7-containing nicotinic receptors.
¡¡	AST	AST-068-10mg	Mirtazepine ¡Ú1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine¡Û¡ÚAntidepressant¡Û¡Ú¦Á2, 5HT2, 5HT3 Antagonist¡Û	10mg	¾È²ñ	+4¡î	61337-67-5
	¡¡ ¡¡ ¡¡ Antagonist at ¦Á2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.
¡¡	AST	AST-068-50mg	Mirtazepine ¡Ú1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine¡Û¡ÚAntidepressant¡Û¡Ú¦Á2, 5HT2, 5HT3 Antagonist¡Û	50mg	¾È²ñ	+4¡î	61337-67-5
	¡¡ ¡¡ ¡¡ Antagonist at ¦Á2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.
¡¡	AST	AST-028-10mg	(-)-MK 801 Maleate ¡Ú5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û	10mg	¾È²ñ	+4¡î	77086-19-2
	¡¡ ¡¡ ¡¡ Less active enantiomer than (+)-MK 801.
¡¡	AST	AST-028-50mg	(-)-MK 801 Maleate ¡Ú5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û	50mg	¾È²ñ	+4¡î	77086-19-2
	¡¡ ¡¡ ¡¡ Less active enantiomer than (+)-MK 801.
¡¡	AST	AST-027-10mg	(+)-MK 801 Maleate ¡ÚDizocilpine¡Û¡Ú(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û	10mg	¾È²ñ	+4¡î	77086-22-7
	¡¡ ¡¡ ¡¡ Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.
¡¡	AST	AST-027-50mg	(+)-MK 801 Maleate ¡ÚDizocilpine¡Û¡Ú(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û	50mg	¾È²ñ	+4¡î	77086-22-7
	¡¡ ¡¡ ¡¡ Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.
¡¡	AST	AST-245-10mg	MMPIP ¡Ú6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one¡Û¡ÚmGlu7 Allosteric Antagonist¡Û	10mg	¾È²ñ	RT	479077-02-6
	¡¡ ¡¡ ¡¡ Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a
¡¡	AST	AST-245-50mg	MMPIP ¡Ú6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one¡Û¡ÚmGlu7 Allosteric Antagonist¡Û	50mg	¾È²ñ	RT	479077-02-6
	¡¡ ¡¡ ¡¡ Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a
¡¡	AST	AST-137-10mg	NG-Monomethyl-L-arginine, Monoacetate salt ¡ÚNG-Methyl-L-arginine Acetate salt¡Û¡ÚNOS Inhibitor¡Û	10mg	¾È²ñ	RT	53308-83-1
	¡¡ ¡¡ ¡¡ Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.
¡¡	AST	AST-137-50mg	NG-Monomethyl-L-arginine, Monoacetate salt ¡ÚNG-Methyl-L-arginine Acetate salt¡Û¡ÚNOS Inhibitor¡Û	50mg	¾È²ñ	RT	53308-83-1
	¡¡ ¡¡ ¡¡ Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.
¡¡	AST	AST-008-10mg	MPEP, HCl ¡Ú2-Methyl-6-(phenylethynyl)pyridine, HCl¡Û	10mg	¾È²ñ	+4¡î	96206-92-7
	¡¡ ¡¡ ¡¡ Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.
¡¡	AST	AST-008-50mg	MPEP, HCl ¡Ú2-Methyl-6-(phenylethynyl)pyridine, HCl¡Û	50mg	¾È²ñ	+4¡î	96206-92-7
	¡¡ ¡¡ ¡¡ Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.
¡¡	AST	AST-205-5mg	¦Á-MSH (free acid) ¡ÚEndogenous Melanocortin Receptor Agonist¡Û	5mg	¾È²ñ	-20¡î	10466-28-1
	¡¡ ¡¡ ¡¡ Free acid form of the endogenous melanocortin receptor agonist involved in feeding, homeostasis, body weight and inflammation. Amino Acids Sequence¡§Ac-SYSMEHFRWGKPV
¡¡	AST	AST-189-1mg	¦Á-MSH ¡ÚEndogenous Melanocortin Receptor Agonist¡Û	1mg	¾È²ñ	-20¡î	581-05-5
	¡¡ ¡¡ ¡¡ Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2
¡¡	AST	AST-189-5mg	¦Á-MSH ¡ÚEndogenous Melanocortin Receptor Agonist¡Û	5mg	¾È²ñ	-20¡î	581-05-5
	¡¡ ¡¡ ¡¡ Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2
¡¡	AST	AST-035-10mg	MTEP, HCl ¡Ú3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side ffects seen with MPEP and benzodiazepi
¡¡	AST	AST-035-50mg	MTEP, HCl ¡Ú3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side effects seen with MPEP and benzodiaze
¡¡	AST	AST-094-5mg	Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û	5mg	¾È²ñ	+4¡î	2763-96-4
	¡¡ ¡¡ ¡¡ Potent, selective GABAA agonist.
¡¡	AST	AST-094-10mg	Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û	10mg	¾È²ñ	+4¡î	2763-96-4
	¡¡ ¡¡ ¡¡ Potent, selective GABAA agonist.
¡¡	AST	AST-094-50mg	Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û	50mg	¾È²ñ	+4¡î	2763-96-4
	¡¡ ¡¡ ¡¡ Potent, selective GABAA agonist.
¡¡	AST	AST-099-5mg	NADA ¡Ú(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous CB1 / TRPV1 Agonist¡Û	5mg	¾È²ñ	-20¡î	199875-69-9
	¡¡ ¡¡ ¡¡ Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 ¦ÌM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.
¡¡	AST	AST-099-25mg	NADA ¡Ú(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous CB1 / TRPV1 Agonist¡Û	25mg	¾È²ñ	-20¡î	199875-69-9
	¡¡ ¡¡ ¡¡ Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 ¦ÌM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.
¡¡	AST	AST-074-100mg	Naloxone, HCl ¡Ú(5¦Á)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl¡Û	100mg	¾È²ñ	+4¡î	357-08-4
	¡¡ ¡¡ ¡¡ Competitive opioid antagonist.
¡¡	AST	AST-074-250mg	Naloxone, HCl ¡Ú(5¦Á)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl¡Û	250mg	¾È²ñ	+4¡î	357-08-4
	¡¡ ¡¡ ¡¡ Competitive opioid antagonist.
¡¡	AST	AST-075-100mg	Naltrexone, HCl ¡Ú(5¦Á)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl¡Û	100mg	¾È²ñ	+4¡î	16676-29-2
	¡¡ ¡¡ ¡¡ Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for ¦Ì, d, and k-receptors respectively.
¡¡	AST	AST-075-250mg	Naltrexone, HCl ¡Ú(5¦Á)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl¡Û	250mg	¾È²ñ	+4¡î	16676-29-2
	¡¡ ¡¡ ¡¡ Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for ¦Ì, d, and k-receptors respectively.
¡¡	AST	AST-045-10mg	NBQX ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide¡Û	10mg	¾È²ñ	+4¡î	118876-58-7
	¡¡ ¡¡ ¡¡ Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.
¡¡	AST	AST-045-50mg	NBQX ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide¡Û	50mg	¾È²ñ	+4¡î	118876-58-7
	¡¡ ¡¡ ¡¡ Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.
¡¡	AST	AST-046-10mg	NBQX, 2Na salt ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.
¡¡	AST	AST-046-50mg	NBQX, 2Na salt ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.
¡¡	AST	AST-185-5mg	Neurokinin A	5mg	¾È²ñ	-20¡î	86933-74-6
	¡¡ ¡¡ ¡¡ Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2
¡¡	AST	AST-185-25mg	Neurokinin A	25mg	¾È²ñ	-20¡î	86933-74-6
	¡¡ ¡¡ ¡¡ Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2
¡¡	AST	AST-174-1mg	Neuropeptide S ¡ÚNPS Receptor Agonist¡Û (mouse)	1mg	¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ
¡¡	AST	AST-246-1mg	Neuropeptide S (mouse)	1mg	¾È²ñ	-20¡î	none
	¡¡ ¡¡ ¡¡ Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ
¡¡	AST	AST-208-0.5mg	Neuropeptide S (rat)	0.5mg	¾È²ñ	-20¡î	412938-75-1
	¡¡ ¡¡ ¡¡ Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ
¡¡	AST	AST-208-1mg	Neuropeptide S (rat)	1mg	¾È²ñ	-20¡î	412938-75-1
	¡¡ ¡¡ ¡¡ Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ
¡¡	AST	AST-171-1mg	Neuropeptide Y (13-36) ¡ÚNPY Y2 Agonist¡Û (porcine)	1mg	¾È²ñ	-20¡î	113662-54-7
	¡¡ ¡¡ ¡¡ Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2
¡¡	AST	AST-171-5mg	Neuropeptide Y (13-36) ¡ÚNPY Y2 Agonist¡Û (porcine)	5mg	¾È²ñ	-20¡î	113662-54-7
	¡¡ ¡¡ ¡¡ Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2
¡¡	AST	AST-145-10g	Nicotinic Acid ¡ÚPyridine-3-carboxylic Acid¡Û¡ÚAntidyslipidemic Agent¡Û	10g	¾È²ñ	RT	59-67-6
	¡¡ ¡¡ ¡¡ Antidyslipidemic. Increases high-density- and lowers low-density lipoproteins. Putative ligand for the HM74A receptor.
¡¡	AST	AST-135-250mg	Nifedipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	250mg	¾È²ñ	+4¡î	21829-25-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.
¡¡	AST	AST-135-1g	Nifedipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	1g	¾È²ñ	+4¡î	21829-25-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.
¡¡	AST	AST-138-100mg	Nimodipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	100mg	¾È²ñ	?׸÷ +4¡î	66085-59-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.
¡¡	AST	AST-138-500mg	Nimodipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	500mg	¾È²ñ	?׸÷ +4¡î	66085-59-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.
¡¡	AST	AST-312-100mg	Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û	100mg	¾È²ñ	RT	60252-41-7
	¡¡ ¡¡ ¡¡ GABA reuptake inhibitor.
¡¡	AST	AST-312-1g	Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û	1g	¾È²ñ	RT	60252-41-7
	¡¡ ¡¡ ¡¡ GABA reuptake inhibitor.
¡¡	AST	AST-312-5g	Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û	5g	¾È²ñ	RT	60252-41-7
	¡¡ ¡¡ ¡¡ GABA reuptake inhibitor.
¡¡	AST	AST-139-100mg	Nitrendipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	100mg	¾È²ñ	RT	39562-70-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Antihypertensive in vivo.
¡¡	AST	AST-139-500mg	Nitrendipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û	500mg	¾È²ñ	RT	39562-70-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Antihypertensive in vivo.
¡¡	AST	AST-136-100mg	N¦Ø-Nitro-L-arginine Methyl Ester, HCl	100mg	¾È²ñ	+4¡î	51298-62-5
	¡¡ ¡¡ ¡¡ Cell permeable NOS inhibitor. More soluble analogue of arginine. pIC50 values are 4.3, 5.7 and 5.6 at human iNOS, nNOA and eNOS respectively.
¡¡	AST	AST-233-50mg	7-Nitroindazole ¡ÚNOS Inhibitor¡Û	50mg	¾È²ñ	-20¡î	2942-42-9
	¡¡ ¡¡ ¡¡ Competitive, reversible and non-selective NOS inhibitor. Neuroprotective, anticonvulsant and anxiolytic in vivo.
¡¡	AST	AST-285--10mg	S-Nitrosoglutathione	10mg	¾È²ñ	-20¡î	57564-91-7
	¡¡ ¡¡ ¡¡ carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.
¡¡	AST	AST-285-50mg	S-Nitrosoglutathione	50mg	¾È²ñ	-20¡î	57564-91-7
	¡¡ ¡¡ ¡¡ carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.
¡¡	AST	AST-063-10mg	(S)-5-Nitrowillardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors
¡¡	AST	AST-063-50mg	(S)-5-Nitrowillardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors
¡¡	AST	AST-190-10mg	NKH 477 ¡ÚN,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester ¦Â-alanine, HCl¡Û	10mg	¾È²ñ	+4¡î	138605-00-2
	¡¡ ¡¡ ¡¡ Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator
¡¡	AST	AST-190-50mg	NKH 477 ¡ÚN,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester ¦Â-alanine, HCl¡Û	50mg	¾È²ñ	+4¡î	138605-00-2
	¡¡ ¡¡ ¡¡ Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator
¡¡	AST	AST-052-50mg	NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û	50mg	¾È²ñ	+4¡î	6384-92-5
	¡¡ ¡¡ ¡¡ Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.
¡¡	AST	AST-052-100mg	NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û	100mg	¾È²ñ	+4¡î	6384-92-5
	¡¡ ¡¡ ¡¡ Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.
¡¡	AST	AST-052-500mg	NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û	500mg	¾È²ñ	+4¡î	6384-92-5
	¡¡ ¡¡ ¡¡ Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.
¡¡	AST	AST-070-1mg	Nociceptin ¡ÚORL1 Agonist¡Û	1mg	¾È²ñ	+4¡î	170713-75-4
	¡¡ ¡¡ ¡¡ Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH
¡¡	AST	AST-070-5mg	Nociceptin ¡ÚORL1 Agonist¡Û	5mg	¾È²ñ	+4¡î	170713-75-4
	¡¡ ¡¡ ¡¡ Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH
¡¡	AST	AST-078-10mg	Nor-Binaltorphimine, 2HCl	10mg	¾È²ñ	+4¡î	105618-26-6
	¡¡ ¡¡ ¡¡ Potent and selective ¦Ê-Opioid receptor antagonist
¡¡	AST	AST-078-50mg	Nor-Binaltorphimine, 2HCl	50mg	¾È²ñ	+4¡î	105618-26-6
	¡¡ ¡¡ ¡¡ Potent and selective ¦Ê-Opioid receptor antagonist
¡¡	AST	AST-071-1mg	Obestatin	1mg	¾È²ñ	+4¡î	869705-22-6
	¡¡ ¡¡ ¡¡ Obestatin, a peptide encoded by the ghrelin gene that suppresses food intake. Binds to the orphan G-protein-coupled receptor GPR39. Amino Acids Sequence:H-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-IIe-Lys-Leu-
¡¡	AST	AST-022-10mg	ODQ ¡Ú1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one¡Û	10mg	¾È²ñ	+4¡î	41443-28-1
	¡¡ ¡¡ ¡¡ Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.
¡¡	AST	AST-022-50mg	ODQ ¡Ú1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one¡Û	50mg	¾È²ñ	+4¡î	41443-28-1
	¡¡ ¡¡ ¡¡ Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.
¡¡	AST	AST-134-10mg	Ondansetron ¡Ú2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one¡Û¡ÚSelective 5HT3 Antagonist¡Û	10mg	¾È²ñ	-20¡î	99614-02-5
	¡¡ ¡¡ ¡¡ Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.
¡¡	AST	AST-134-50mg	Ondansetron ¡Ú2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one¡Û¡ÚSelective 5HT3 Antagonist¡Û	50mg	¾È²ñ	-20¡î	99614-02-5
	¡¡ ¡¡ ¡¡ Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.
¡¡	AST	AST-212-0.1mg	Orexin A (bovine, human, mouse, rat)	0.1mg	¾È²ñ	-20¡î	205640-90-0
	¡¡ ¡¡ ¡¡ Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14
¡¡	AST	AST-212-0.5mg	Orexin A (bovine, human, mouse, rat)	0.5mg	¾È²ñ	-20¡î	205640-90-0
	¡¡ ¡¡ ¡¡ Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14
¡¡	AST	AST-212-1mg	Orexin A (bovine, human, mouse, rat)	1mg	¾È²ñ	-20¡î	205640-90-0
	¡¡ ¡¡ ¡¡ Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14
¡¡	AST	AST-186-5mg	Oxytocin ¡ÚReproductive Hormone¡Û	5mg	¾È²ñ	-20¡î	50-56-6
	¡¡ ¡¡ ¡¡ Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-
¡¡	AST	AST-186-25mg	Oxytocin ¡ÚReproductive Hormone¡Û	25mg	¾È²ñ	-20¡î	50-56-6
	¡¡ ¡¡ ¡¡ Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-
¡¡	AST	AST-204-5mg	Oxytocin ¡ÚReproductive Hormone¡Û, free-acid	5mg	¾È²ñ	-20¡î	24346-32-5
	¡¡ ¡¡ ¡¡ Free acid form of oxytocin, which is a hormone involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino A
¡¡	AST	AST-143-10mg	Paclitaxel ¡ÚAnticancer Agent¡Û	10mg	¾È²ñ	-20¡î	33069-62-4
	¡¡ ¡¡ ¡¡ Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.
¡¡	AST	AST-143-50mg	Paclitaxel ¡ÚAnticancer Agent¡Û	50mg	¾È²ñ	-20¡î	33069-62-4
	¡¡ ¡¡ ¡¡ Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.
¡¡	AST	AST-069-10mg	Paroxetine, HCl ¡Ú(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl¡Û¡Ú5HT Uptake Inhibitor¡Û	10mg	¾È²ñ	+4¡î	110429-35-1
	¡¡ ¡¡ ¡¡ Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.
¡¡	AST	AST-069-50mg	Paroxetine, HCl ¡Ú(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl¡Û¡Ú5HT Uptake Inhibitor¡Û	50mg	¾È²ñ	+4¡î	110429-35-1
	¡¡ ¡¡ ¡¡ Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.
¡¡	AST	AST-234-1mg	PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û	1mg	¾È²ñ	RT	167869-21-8
	¡¡ ¡¡ ¡¡ Inhibitor of MKK1 (MEK1).
¡¡	AST	AST-234-10mg	PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û	10mg	¾È²ñ	RT	167869-21-8
	¡¡ ¡¡ ¡¡ Inhibitor of MKK1 (MEK1).
¡¡	AST	AST-234-50mg	PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û	50mg	¾È²ñ	RT	167869-21-8
	¡¡ ¡¡ ¡¡ Inhibitor of MKK1 (MEK1).
¡¡	AST	AST-043-10mg	PHCCC ¡Ú(E)-1,1¦Á,7,7¦Á-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1¦Á-carboxamide¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.
¡¡	AST	AST-043-50mg	PHCCC ¡Ú(E)-1,1¦Á,7,7¦Á-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1¦Á-carboxamide¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.
·àʪ	AST	AST-335-1mg	Philanthotoxin-7,4 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û	1mg	¾È²ñ	RT	401601-12-5
	¡¡ ¡¡ ¡¡ A subtype-selective, use-dependent inhibitor of native AMPA receptors. Inhibits GluA1/A2 (formerly GluR1/2), with little activity at GluA2/A3 (formerly GluR2/3)
¡¡	AST	AST-297-1mg	Phorbol 12-Myristate 13-Acetate	1mg	¾È²ñ	-20¡î	16561-29-8
	¡¡ ¡¡ ¡¡ Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non
¡¡	AST	AST-297-5mg	Phorbol 12-Myristate 13-Acetate	5mg	¾È²ñ	-20¡î	16561-29-8
	¡¡ ¡¡ ¡¡ Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non
¡¡	AST	AST-297-25mg	Phorbol 12-Myristate 13-Acetate	25mg	¾È²ñ	-20¡î	16561-29-8
	¡¡ ¡¡ ¡¡ Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non
¡¡	AST	AST-079-0.5mg	Phospho-Glycogen Synthase Peptide-2	0.5mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE
¡¡	AST	AST-079-1mg	Phospho-Glycogen Synthase Peptide-2	1mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE
¡¡	AST	AST-315-1g	Picrotoxin	1g	¾È²ñ	-20¡î	124-87-8
	¡¡ ¡¡ ¡¡ Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin
¡¡	AST	AST-315-5g	Picrotoxin	5g	¾È²ñ	-20¡î	124-87-8
	¡¡ ¡¡ ¡¡ Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin
¡¡	AST	AST-038-50mg	2,3 cis-Piperidine dicarboxylic Acid ¡Úcis-PDA¡Û¡Úcis-Piperidine-2,3-dicarboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	46026-75-9
	¡¡ ¡¡ ¡¡ General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.
¡¡	AST	AST-038-250mg	2,3 cis-Piperidine dicarboxylic Acid ¡Úcis-PDA¡Û¡Úcis-Piperidine-2,3-dicarboxylic Acid¡Û	250mg	¾È²ñ	+4¡î	46026-75-9
	¡¡ ¡¡ ¡¡ General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.
¡¡	AST	AST-153-100mg	Pirenzepine, 2HCl ¡Ú5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl¡Û¡ÚM1 Antagonist¡Û	100mg	¾È²ñ	RT	28797-61-7
	¡¡ ¡¡ ¡¡ Selective M1 receptor antagonist.
¡¡	AST	AST-153-500mg	Pirenzepine, 2HCl ¡Ú5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl¡Û¡ÚM1 Antagonist¡Û	500mg	¾È²ñ	RT	28797-61-7
	¡¡ ¡¡ ¡¡ Selective M1 receptor antagonist.
¡¡	AST	AST-308-1mg	PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û	1mg	¾È²ñ	+4¡î	172889-27-9
	¡¡ ¡¡ ¡¡ Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel
¡¡	AST	AST-308-5mg	PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û	5mg	¾È²ñ	+4¡î	172889-27-9
	¡¡ ¡¡ ¡¡ Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel
¡¡	AST	AST-308-10mg	PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û	10mg	¾È²ñ	+4¡î	172889-27-9
	¡¡ ¡¡ ¡¡ Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel
¡¡	AST	AST-009-10mg	PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û	10mg	¾È²ñ	-20¡î	149017-66-3
	¡¡ ¡¡ ¡¡ P2 purinergic receptor antagonist.
¡¡	AST	AST-009-50mg	PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û	50mg	¾È²ñ	-20¡î	149017-66-3
	¡¡ ¡¡ ¡¡ P2 purinergic receptor antagonist.
¡¡	AST	AST-009-250mg	PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û	250mg	¾È²ñ	-20¡î	149017-66-3
	¡¡ ¡¡ ¡¡ P2 purinergic receptor antagonist.
¡¡	AST	AST-047-10mg	cis-PPDA ¡Ú(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 ¦ÌM, 0.125 ¦ÌM, 0.55 ¦ÌM and 0.31 ¦ÌM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.
¡¡	AST	AST-047-50mg	cis-PPDA ¡Ú(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 ¦ÌM, 0.125 ¦ÌM, 0.55 ¦ÌM and 0.31 ¦ÌM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.
¡¡	AST	AST-161-10mg	PPT ¡Ú4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol¡Û¡ÚSubtype selective ER¦Á Agonist¡Û	10mg	¾È²ñ	+4¡î	263717-53-9
	¡¡ ¡¡ ¡¡ Potent, subtype selective ER¦Á estrogen receptor agonist. Over 400-fold selective for ER¦Á over ER¦Â receptors.
¡¡	AST	AST-161-50mg	PPT ¡Ú4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol¡Û¡ÚSubtype selective ER¦Á Agonist¡Û	50mg	¾È²ñ	+4¡î	263717-53-9
	¡¡ ¡¡ ¡¡ Potent, subtype selective ER¦Á estrogen receptor agonist. Over 400-fold selective for ER¦Á over ER¦Â receptors.
¡¡	AST	AST-238-50mg	Prazosin, HCl ¡Ú[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl¡Û¡Ú¦Á-Adrenoceptor Antagonist¡Û	50mg	¾È²ñ	+4¡î	19237-84-4
	¡¡ ¡¡ ¡¡ Peripheral ¦Á1- and ¦Á2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.
¡¡	AST	AST-238-250mg	Prazosin, HCl ¡Ú[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl¡Û¡Ú¦Á-Adrenoceptor Antagonist¡Û	250mg	¾È²ñ	+4¡î	19237-84-4
	¡¡ ¡¡ ¡¡ Peripheral ¦Á1- and ¦Á2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.
¡¡	AST	AST-334-1g	Propofol ¡Ú2,6-Diisopropylphenol¡Û	1g	¾È²ñ	RT	2078-54-8
	¡¡ ¡¡ ¡¡ GABAA agonist. Short-acting intravenous anaesthetic agent. Stimulates constitutive nitric oxide (NO) production and inhibits inducible NO production. Also has anxiolytic properties, antioxidant, immun
¡¡	AST	AST-304-1mg	Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û	1mg	¾È²ñ	+4¡î	212844-53-6
	¡¡ ¡¡ ¡¡ Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).
¡¡	AST	AST-304-10mg	Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û	10mg	¾È²ñ	+4¡î	212844-53-6
	¡¡ ¡¡ ¡¡ Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).
¡¡	AST	AST-304-50mg	Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û	50mg	¾È²ñ	+4¡î	212844-53-6
	¡¡ ¡¡ ¡¡ Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).
¡¡	AST	AST-305-10mg	Purvalanol B ¡Ú4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid¡Û	10mg	¾È²ñ	+4¡î	212844-54-7
	¡¡ ¡¡ ¡¡ Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas
¡¡	AST	AST-305-50mg	Purvalanol B ¡Ú4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid¡Û	50mg	¾È²ñ	+4¡î	212844-54-7
	¡¡ ¡¡ ¡¡ Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas
¡¡	AST	AST-247-100mg	Quercetin ¡Ú2-(3,4-Dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one¡Û	100mg	¾È²ñ	RT	6151-25-3
	¡¡ ¡¡ ¡¡ Anti-oxidative flavonoid. Anticancer, antithrombotic and anti-inflammatory agent. Actions include inhibition of mitochondrial ATPase, phosphodiesterases, PI3-kinase and PIP kinase activity.
¡¡	AST	AST-010-5mg	Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û	5mg	¾È²ñ	+4¡î	52809-07-1
	¡¡ ¡¡ ¡¡ Potent group I mGlu agonist and AMPA receptor agonist.
¡¡	AST	AST-010-10mg	Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û	10mg	¾È²ñ	+4¡î	52809-07-1
	¡¡ ¡¡ ¡¡ Potent group I mGlu agonist and AMPA receptor agonist.
¡¡	AST	AST-010-50mg	Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û	50mg	¾È²ñ	+4¡î	52809-07-1
	¡¡ ¡¡ ¡¡ Potent group I mGlu agonist and AMPA receptor agonist.
¡¡	AST	AST-126-10mg	QX-222 ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û	10mg	¾È²ñ	-20¡î	21236-55-5
	¡¡ ¡¡ ¡¡ Na+ channel blocker. Lidocaine derivative.
¡¡	AST	AST-126-50mg	QX-222 ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û	50mg	¾È²ñ	-20¡î	21236-55-5
	¡¡ ¡¡ ¡¡ Na+ channel blocker. Lidocaine derivative.
¡¡	AST	AST-117-50mg	QX-314 Bromide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide¡Û¡ÚNa+ Channel Blocker¡Û	50mg	¾È²ñ	+4¡î	21306-56-9
	¡¡ ¡¡ ¡¡ A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.
¡¡	AST	AST-117-100mg	QX-314 Bromide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide¡Û¡ÚNa+ Channel Blocker¡Û	100mg	¾È²ñ	+4¡î	21306-56-9
	¡¡ ¡¡ ¡¡ A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.
¡¡	AST	AST-118-50mg	QX-314 Chloride ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û	50mg	¾È²ñ	+4¡î	5369-03-9
	¡¡ ¡¡ ¡¡ A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ channels
¡¡	AST	AST-224-1mg	Rapamycin ¡ÚImmunosuppressant¡Û	1mg	¾È²ñ	-20¡î	53123-88-9
	¡¡ ¡¡ ¡¡ Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin
¡¡	AST	AST-224-5mg	Rapamycin ¡ÚImmunosuppressant¡Û	5mg	¾È²ñ	-20¡î	53123-88-9
	¡¡ ¡¡ ¡¡ Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin
¡¡	AST	AST-236-10mg	Rasagiline Mesylate ¡Ú(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate¡Û	10mg	¾È²ñ	+4¡î	161735-79-1
	¡¡ ¡¡ ¡¡ Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti
¡¡	AST	AST-236-50mg	Rasagiline Mesylate ¡Ú(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate¡Û	50mg	¾È²ñ	+4¡î	161735-79-1
	¡¡ ¡¡ ¡¡ Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti
¡¡	AST	AST-157-10mg	Reboxetine Mesylate ¡Ú(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine¡Û¡ÚNoradrenaline Reuptake Inhibitor¡Û	10mg	¾È²ñ	+4¡î	71620-89-8
	¡¡ ¡¡ ¡¡ Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.
¡¡	AST	AST-157-50mg	Reboxetine Mesylate ¡Ú(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine¡Û¡ÚNoradrenaline Reuptake Inhibitor¡Û	50mg	¾È²ñ	+4¡î	71620-89-8
	¡¡ ¡¡ ¡¡ Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.
¡¡	AST	AST-272-10mg	Riluzole ¡Ú2-Amino-6-trifluoromethoxybenzothiazole, HCl¡Û	10mg	¾È²ñ	RT	1744-22-5
	¡¡ ¡¡ ¡¡ Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,
¡¡	AST	AST-272-50mg	Riluzole ¡Ú2-Amino-6-trifluoromethoxybenzothiazole, HCl¡Û	50mg	¾È²ñ	RT	1744-22-5
	¡¡ ¡¡ ¡¡ Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,
¡¡	AST	AST-031-10mg	(R)-(-)-Rolipram ¡Ú(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one¡Û	10mg	¾È²ñ	+4¡î	85416-75-7
	¡¡ ¡¡ ¡¡ Selective PDE4 inhibitor (IC50 = 0.22 ¦ÌM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.
¡¡	AST	AST-031-50mg	(R)-(-)-Rolipram ¡Ú(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one¡Û	50mg	¾È²ñ	+4¡î	85416-75-7
	¡¡ ¡¡ ¡¡ Selective PDE4 inhibitor (IC50 = 0.22 ¦ÌM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.
¡¡	AST	AST-029-10mg	(R,S)-Rolipram ¡Ú(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û	10mg	¾È²ñ	+4¡î	61413-54-5
	¡¡ ¡¡ ¡¡ Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 ¦ÌM and 0.17 ¦ÌM for inhibition of mouse PDE4A1 and PDE4B respectively)
¡¡	AST	AST-029-50mg	(R,S)-Rolipram ¡Ú(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û	50mg	¾È²ñ	+4¡î	61413-54-5
	¡¡ ¡¡ ¡¡ Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 ¦ÌM and 0.17 ¦ÌM for inhibition of mouse PDE4A1 and PDE4B respectively)
¡¡	AST	AST-030-10mg	(S)-(+)-Rolipram ¡Ú(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û	10mg	¾È²ñ	+4¡î	85416-73-5
	¡¡ ¡¡ ¡¡ PDE4 inhibitor (IC50 = 0.58 ¦ÌM). Less active enantiomer.
¡¡	AST	AST-030-50mg	(S)-(+)-Rolipram ¡Ú(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û	50mg	¾È²ñ	+4¡î	85416-73-5
	¡¡ ¡¡ ¡¡ PDE4 inhibitor (IC50 = 0.58 ¦ÌM). Less active enantiomer.
¡¡	AST	AST-290-1mg	Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û	1mg	¾È²ñ	RT	169274-78-6
	¡¡ ¡¡ ¡¡ Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant
¡¡	AST	AST-290-10mg	Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û	10mg	¾È²ñ	RT	169274-78-6
	¡¡ ¡¡ ¡¡ Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant
¡¡	AST	AST-290-50mg	Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û	50mg	¾È²ñ	RT	169274-78-6
	¡¡ ¡¡ ¡¡ Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant
¡¡	AST	AST-264-100mg	Ruthenium Red	100mg	¾È²ñ	RT	11103-72-3
	¡¡ ¡¡ ¡¡ Inhibitor of calcium signalling with multiple actions. Inhibits the mitochondrial Ca2+ uniporter, Ca2+-ATPase, troponin C and calmodulin. Attenuates capsaicin-induced cation channel opening. Inhibits
¡¡	AST	AST-083-1mg	Ryanodine ¡Ú1H-Pyrrole-2-carboxylic Acid, (3S,4R,4¦ÁR,6S,7S,8R,8¦ÁS,8¦ÂR,9S,9¦ÁS)-Dodecahydro-4,6,7,8¦Á,8¦Â,9¦Á-hexahydroxy- 3,6¦Á,9-trimethyl-7-(1-methylethyl)-6,9-methanobenzo[1,2] pentaleno[1,6-bc	1mg	¾È²ñ	-20¡î	15662-33-6
	¡¡ ¡¡ ¡¡ Alkaloid that binds with high affinity to ryanodine receptors to modulate intracellular Ca2+ release. Has complex actions and may stimulate or inhibit Ca2+ release, depending on the concentration used
¡¡	AST	AST-327-10mg	Saclofen ¡Ú3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid¡Û	10mg	¾È²ñ	RT	125464-42-8
	¡¡ ¡¡ ¡¡ GABAB antagonist
¡¡	AST	AST-327-50mg	Saclofen ¡Ú3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid¡Û	50mg	¾È²ñ	RT	125464-42-8
	¡¡ ¡¡ ¡¡ GABAB antagonist
¡¡	AST	AST-084	Salvinorin A <<< Í¢Æþ¶Ø?ß >>>		¾È²ñ		83729-01-5
	¡¡ ¡¡ ¡¡ Potent ¦Ê agonist (Ki = 8-19 nM). Psychoactive and antinociceptive in vivo. Reported to be an allosteric modulator of ¦Ì opiod receptors.
¡¡	AST	AST-182-1mg	SAMS peptide ¡ÚAMP-activated Protein Kinase Substrate¡Û	1mg	¾È²ñ	-20¡î	125911-68-4
	¡¡ ¡¡ ¡¡ Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR
¡¡	AST	AST-182-5mg	SAMS peptide ¡ÚAMP-activated Protein Kinase Substrate¡Û	5mg	¾È²ñ	-20¡î	125911-68-4
	¡¡ ¡¡ ¡¡ Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR
¡¡	AST	AST-162-1mg	SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û	1mg	¾È²ñ	+4¡î	152121-47-6
	¡¡ ¡¡ ¡¡ Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.
¡¡	AST	AST-162-10mg	SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û	10mg	¾È²ñ	+4¡î	152121-47-6
	¡¡ ¡¡ ¡¡ Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.
¡¡	AST	AST-162-50mg	SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û	50mg	¾È²ñ	+4¡î	152121-47-6
	¡¡ ¡¡ ¡¡ Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.
¡¡	AST	AST-202-1mg	SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û	1mg	¾È²ñ	+4¡î	280744-09-4
	¡¡ ¡¡ ¡¡ Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra
¡¡	AST	AST-202-10mg	SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û	10mg	¾È²ñ	+4¡î	280744-09-4
	¡¡ ¡¡ ¡¡ Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra
¡¡	AST	AST-202-50mg	SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û	50mg	¾È²ñ	+4¡î	280744-09-4
	¡¡ ¡¡ ¡¡ Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra
¡¡	AST	AST-163-1mg	SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û	1mg	¾È²ñ	RT	301836-41-9
	¡¡ ¡¡ ¡¡ Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.
¡¡	AST	AST-163-10mg	SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û	10mg	¾È²ñ	RT	301836-41-9
	¡¡ ¡¡ ¡¡ Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.
¡¡	AST	AST-163-50mg	SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û	50mg	¾È²ñ	RT	301836-41-9
	¡¡ ¡¡ ¡¡ Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.
¡¡	AST	AST-235-10mg	SB 203580, HCl ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine, HCl¡Û¡Úp38 MAP Kinase Inhibitor; water soluble¡Û	10mg	¾È²ñ	+4¡î	152121-47-6 (free base)
	¡¡ ¡¡ ¡¡ Water soluble, cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.
¡¡	AST	AST-062-10mg	(S)-5-Chlorowillardiine ¡Ú(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚAMPA / Kainate Agonist¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent AMPA / kainate receptor agonist
¡¡	AST	AST-062-50mg	(S)-5-Chlorowillardiine ¡Ú(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚAMPA / Kainate Agonist¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent AMPA / kainate receptor agonist
¡¡	AST	AST-048-1g	D-Serine ¡Ú(R)-2-Amino-3-hydroxypropanoic Acid¡Û	1g	¾È²ñ	+4¡î	56-45-1
	¡¡ ¡¡ ¡¡ Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.
¡¡	AST	AST-048-5g	D-Serine ¡Ú(R)-2-Amino-3-hydroxypropanoic Acid¡Û	5g	¾È²ñ	+4¡î	56-45-1
	¡¡ ¡¡ ¡¡ Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.
¡¡	AST	AST-280-10mg	SKF 96365 ¡Ú1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl¡Û	10mg	¾È²ñ	RT	130495-35-1
	¡¡ ¡¡ ¡¡ Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .
¡¡	AST	AST-280-50mg	SKF 96365 ¡Ú1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl¡Û	50mg	¾È²ñ	RT	130495-35-1
	¡¡ ¡¡ ¡¡ Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .
¡¡	AST	AST-250-10mg	SKF 97541 ¡Ú3-Aminopropyl(methyl)phosphinic Acid¡Û	10mg	¾È²ñ	RT	127729-35-5
	¡¡ ¡¡ ¡¡ Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 ¦ÌM for SKF97541 and baclofen respectively.
¡¡	AST	AST-250-50mg	SKF 97541 ¡Ú3-Aminopropyl(methyl)phosphinic Acid¡Û	50mg	¾È²ñ	RT	127729-35-5
	¡¡ ¡¡ ¡¡ Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 ¦ÌM for SKF97541 and baclofen respectively.
¡¡	AST	AST-326-10£í£ç	SKF 89976A, HCl ¡Ú1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl¡Û	10mg	¾È²ñ	+4¡î	85375-15-1
	¡¡ ¡¡ ¡¡ A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 ¦ÌM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu
¡¡	AST	AST-326-50mg	SKF 89976A, HCl ¡Ú1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl¡Û	50mg	¾È²ñ	+4¡î	85375-15-1
	¡¡ ¡¡ ¡¡ A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 ¦ÌM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu
·àʪ	AST	AST-082-10mg	SL 327 ¡Ú¦Á-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile¡Û	10mg	¾È²ñ	+4¡î	305350-87-2
	¡¡ ¡¡ ¡¡ Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 ¦ÌM and 0.22 ¦ÌM respectively).
·àʪ	AST	AST-082-25mg	SL 327 ¡Ú¦Á-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile¡Û	25mg	¾È²ñ	+4¡î	305350-87-2
	¡¡ ¡¡ ¡¡ Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 ¦ÌM and 0.22 ¦ÌM respectively).
¡¡	AST	AST-176-1mg	SLIGRL-NH2 ¡ÚPAR2 Agonist Peptide¡Û	1mg	¾È²ñ	-20¡î	171436-38-7
	¡¡ ¡¡ ¡¡ Proteinase-activated receptor-2 activating (PAR2) agonist peptide. Amino Acids Sequence:SLIGRL-NH2
¡¡	AST	AST-014-10mg	SNAP ¡ÚS-Nitroso-N-acetyl-DL-penicillamine¡Û	10mg	¾È²ñ	-20¡î	67776-06-1
	¡¡ ¡¡ ¡¡ NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.
¡¡	AST	AST-014-50mg	SNAP ¡ÚS-Nitroso-N-acetyl-DL-penicillamine¡Û	50mg	¾È²ñ	-20¡î	67776-06-1
	¡¡ ¡¡ ¡¡ NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.
¡¡	AST	AST-259-10ug	SNX 482	10ug	¾È²ñ	-20¡î	203460-30-4
	¡¡ ¡¡ ¡¡ Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (¦Á1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent
¡¡	AST	AST-259-0.1mg	SNX 482	0.1mg	¾È²ñ	-20¡î	203460-30-4
	¡¡ ¡¡ ¡¡ Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (¦Á1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent
¡¡	AST	AST-065-10mg	SP600125 ¡Ú1,9-Pyrazoloanthrone¡Û	10mg	¾È²ñ	+4¡î	129-56-6
	¡¡ ¡¡ ¡¡ Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 ¦ÌM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the
¡¡	AST	AST-065-50mg	SP600125 ¡Ú1,9-Pyrazoloanthrone¡Û	50mg	¾È²ñ	+4¡î	129-56-6
	¡¡ ¡¡ ¡¡ Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 ¦ÌM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the
¡¡	AST	AST-057-100mg	Spermidine, 3HCl ¡ÚN-(3-Aminopropyl)butane-1,4-diamine, 3HCl¡Û	100mg	¾È²ñ	+4¡î	334-50-9
	¡¡ ¡¡ ¡¡ Endogenous polyamine, that binds to the polyamine modulatory site of the NMDA receptor. Inhibits neuronal nitric oxide synthase (nNOS). Binds and precipitates DNA; may be used for purification of DNA
¡¡	AST	AST-051-100mg	Spermine ¡ÚN1,N4-bis(3-Aminopropyl)butane-1,4-diamine¡Û	100mg	¾È²ñ	+4¡î	77-44-3
	¡¡ ¡¡ ¡¡ Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.
¡¡	AST	AST-051-1g	Spermine ¡ÚN1,N4-bis(3-Aminopropyl)butane-1,4-diamine¡Û	1g	¾È²ñ	+4¡î	77-44-3
	¡¡ ¡¡ ¡¡ Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.
¡¡	AST	AST-042-10mg	SR95531 ¡ÚGabazine¡Û¡Ú2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide¡Û	10mg	¾È²ñ	+4¡î	104105-50-9
	¡¡ ¡¡ ¡¡ Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.
¡¡	AST	AST-042-50mg	SR95531 ¡ÚGabazine¡Û¡Ú2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide¡Û	50mg	¾È²ñ	+4¡î	104105-50-9
	¡¡ ¡¡ ¡¡ Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.
¡¡	AST	AST-056-0.1mg	Staurosporine ¡Ú[9S-(9¦Á,10¦Â,11¦Â,13¦Á)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3¡Ç,2¡Ç,1¡Ç-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one¡Û	0.1mg	¾È²ñ	+4¡î	62996-74-1
	¡¡ ¡¡ ¡¡ Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)
¡¡	AST	AST-056-0.5mg	Staurosporine ¡Ú[9S-(9¦Á,10¦Â,11¦Â,13¦Á)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3¡Ç,2¡Ç,1¡Ç-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one¡Û	0.5mg	¾È²ñ	+4¡î	62996-74-1
	¡¡ ¡¡ ¡¡ Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)
¡¡	AST	AST-170-1mg	Substanvce P ¡ÚSensory Neuropeptide¡Û	1mg	¾È²ñ	-20¡î	33507-63-0
	¡¡ ¡¡ ¡¡ Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2
¡¡	AST	AST-170-5mg	Substanvce P ¡ÚSensory Neuropeptide¡Û	5mg	¾È²ñ	-20¡î	33507-63-0
	¡¡ ¡¡ ¡¡ Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2
¡¡	AST	AST-090	DL-TBOA ¡ÚDL-threo-¦Â-Benzyloxyaspartic Acid¡Û - - - Discontinued		¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ Potent, competitive, non-transportable EAAT inhibitor (IC50 values are 48, 7 and 8 ¦ÌM at EAAT1-3 respectively). Neurotoxic and convulsant in vivo.
¡¡	AST	AST-276-100mg	tBuBHQ ¡Ú2,5-Di-tert-butylhydroquinone¡Û	100mg	¾È²ñ	RT	88-58-4
	¡¡ ¡¡ ¡¡ Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor
¡¡	AST	AST-276-500mg	tBuBHQ ¡Ú2,5-Di-tert-butylhydroquinone¡Û	500mg	¾È²ñ	RT	88-58-4
	¡¡ ¡¡ ¡¡ Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor
¡¡	AST	AST-270-100mg	Terfenadin ¡Ú1-(4-tert-Butylphenyl)-4-[4-(hydroxydiphenylmethyl)piperidin-1-yl]butan-1-ol¡Û	100mg	¾È²ñ	+4¡î	50679-08-8
	¡¡ ¡¡ ¡¡ K+ channel blocker (Kv11.1). Blocks ATP-sensitive K+ channels (IC50 = 1.2 ¦ÌM). H1 receptor antagonist.
¡¡	AST	AST-275-50mg	N,N,N,N-Tetraethylammonium Chloride ¡ÚTEA¡Û	50mg	¾È²ñ	RT	56-34-8
	¡¡ ¡¡ ¡¡ Non-selective K+ channel blocker (6TM family of K+ channels).
¡¡	AST	AST-054-1mg	Tetrodotoxin ¡ÚOctahydro-12-(hydroxymethyl)-2-imino-5,9:7,10¦Á-dimethano-10¦ÁH-[1,3]dioxocino[6,5-d]pyrimidine-4,7,10,11,12-pentol¡Û	1mg	¾È²ñ	-20¡î	4368-28-9
	¡¡ ¡¡ ¡¡ Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.
¡¡	AST	AST-055-1mg	Tetrodotoxin Citrate	1mg	¾È²ñ	-20¡î	18660-81-6
	¡¡ ¡¡ ¡¡ Water soluble citrate salt of tetrodotoxin. Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.
¡¡	AST	AST-177-1mg	TFLLR-NH2 ¡ÚPAR1 Agonist Peptide¡Û	1mg	¾È²ñ	-20¡î	197794-83-5
	¡¡ ¡¡ ¡¡ Proteinase-activated receptor-1 activating (PAR1) agonist peptide. Amino Acids Sequence:TFLLR-NH2
¡¡	AST	AST-032-100mg	(+/-)-Thalidomide ¡ÚN-(2,6-Dioxo-3-piperidinyl)phthalimide¡Û	100mg	¾È²ñ	+4¡î	50-35-1
	¡¡ ¡¡ ¡¡ Immunomodulator. Antiproliferative, anti-angiogenic and pro-apoptotic.
¡¡	AST	AST-286-1mg	Thapsigargin	1mg	¾È²ñ	-20¡î	67526-95-8
	¡¡ ¡¡ ¡¡ A potent, cell-permeable Ca2+-ATPase inhibitor. Releases Ca2+ by inhibiting endoplasmic reticular Ca2+-ATPase (IC50 = 4-13 nM). Both tumorogenic and apoptotic actions reported.
¡¡	AST	AST-155-10mg	L-Thio-AP4 ¡Ú(2S)-2-Amino-4-(hydroxymercaptophosphinyl)butanoic Acid¡Û - - - Discontinued	10mg	¾È²ñ	+4¡î	373644-25-8
	¡¡ ¡¡ ¡¡ Potent Group III mGlu agonist - two-fold more potent than L-AP4. EC50 values are 0.039, 0.73, 197, 0.054 ¦ÌM at mGlu4, 6, 7, 8 respectively.
¡¡	AST	AST-021-10mg	Thioperamide Maleate ¡ÚN-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate¡Û	10mg	¾È²ñ	+4¡î	106243-16-7
	¡¡ ¡¡ ¡¡ Potent, selective H3 antagonist that crosses the blood-brain barrier.
¡¡	AST	AST-021-50mg	Thioperamide Maleate ¡ÚN-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate¡Û	50mg	¾È²ñ	+4¡î	106243-16-7
	¡¡ ¡¡ ¡¡ Potent, selective H3 antagonist that crosses the blood-brain barrier.
¡¡	AST	AST-237-10mg	Tiagabine, HCl ¡Ú(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl¡Û	10mg	¾È²ñ	+4¡î	115103-54-3 (free base)
	¡¡ ¡¡ ¡¡ GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.
¡¡	AST	AST-237-50mg	Tiagabine, HCl ¡Ú(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl¡Û	50mg	¾È²ñ	+4¡î	115103-54-3 (free base)
	¡¡ ¡¡ ¡¡ GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.
¡¡	AST	AST-289-10mg	TMCB ¡Ú2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid¡Û	10mg	¾È²ñ	RT	905105-89-7
	¡¡ ¡¡ ¡¡ CK2 inhibitor (Ki = 0.25 ¦ÌM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 ¦ÌM respectively) and a more favourable
¡¡	AST	AST-289-50mg	TMCB ¡Ú2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid¡Û	50mg	¾È²ñ	RT	905105-89-7
	¡¡ ¡¡ ¡¡ CK2 inhibitor (Ki = 0.25 ¦ÌM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 ¦ÌM respectively) and a more favourable
¡¡	AST	AST-278-100mg	Tolubutamide ¡Ú1-Butyl-3-tosylurea¡Û	100mg	¾È²ñ	RT	64-77-7
	¡¡ ¡¡ ¡¡ Blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.
¡¡	AST	AST-156-10mg	Tropisetron, HCl ¡Ú(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl¡Û¡Ú5-HT3 Antagonist¡Û	10mg	¾È²ñ	RT	105826-92-4
	¡¡ ¡¡ ¡¡ 5HT3 agonist. Potent, orally active anti-emetic. Also ¦Á7 nicotinic receptor partial agonist.
¡¡	AST	AST-156-50mg	Tropisetron, HCl ¡Ú(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl¡Û¡Ú5-HT3 Antagonist¡Û	50mg	¾È²ñ	RT	105826-92-4
	¡¡ ¡¡ ¡¡ 5HT3 agonist. Potent, orally active anti-emetic. Also ¦Á7 nicotinic receptor partial agonist.
·àʪ	AST	AST-073-10mg	(+)-Tubocurarine ¡Ú(+)-Tubocurarine chloride¡Û¡ÚACh Receptor Antagonist¡Û	10mg	¾È²ñ	+4¡î	57-94-3
	¡¡ ¡¡ ¡¡ Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis
·àʪ	AST	AST-073-50mg	(+)-Tubocurarine ¡Ú(+)-Tubocurarine chloride¡Û¡ÚACh Receptor Antagonist¡Û	50mg	¾È²ñ	+4¡î	57-94-3
	¡¡ ¡¡ ¡¡ Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis
¡¡	AST	AST-296-10mg	Tunicamycin from Streptomyces sp.	10mg	¾È²ñ	+4¡î	11089-65-9
	¡¡ ¡¡ ¡¡ Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho
¡¡	AST	AST-296-50mg	Tunicamycin from Streptomyces sp.	50mg	¾È²ñ	+4¡î	11089-65-9
	¡¡ ¡¡ ¡¡ Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho
·àʪ	AST	AST-241-5mg	U0126 ¡Ú1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene¡Û¡ÚSelective MKK Inhibitor¡Û	5mg	¾È²ñ	+4¡î	109511-58-2
	¡¡ ¡¡ ¡¡ Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 ¦ÌM respectively) and MKK5 with little or no effect on a wide range of other kinases.
·àʪ	AST	AST-241-25mg	U0126 ¡Ú1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene¡Û¡ÚSelective MKK Inhibitor¡Û	25mg	¾È²ñ	+4¡î	109511-58-2
	¡¡ ¡¡ ¡¡ Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 ¦ÌM respectively) and MKK5 with little or no effect on a wide range of other kinases.
¡¡	AST	AST-101-10mg	U 93631 ¡Útert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate¡Û	10mg	¾È²ñ	RT	152273-12-6
	¡¡ ¡¡ ¡¡ GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c
¡¡	AST	AST-101-50mg	U 93631 ¡Útert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate¡Û	50mg	¾È²ñ	RT	152273-12-6
	¡¡ ¡¡ ¡¡ GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c
¡¡	AST	AST-193-10mg	UBP141 ¡Ú(2R*,3S*)-1-(Phenanthrenyl-3-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û¡ÚNR2D Antagonist, with some subunit selectivity¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ NR2D antagonist, displaying modest subunit selectivity. Shows 7-fold selectivity for NR2C and/or NR2D-containing NMDA receptors and 5-fold selectivity over NR2A-containing receptors.
¡¡	AST	AST-194-10mg	UBP304 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione¡Û¡ÚPotent, selective GLUK5 Receptor Antagonist¡Û	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Potent, selective GLUK5 receptor antagonist (Kd = 105 nM). Selective over homomeric GLUK6, GLUK7 and GLUA1-4 AMPA receptors (IC50 >100 ¦ÌM), and displays over 500-fold selectivity over NMDA or Group I
¡¡	AST	AST-195-10mg	UBP308 ¡Ú(R)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione¡Û¡ÚInactive Isomer of the GLUK5 Receptor Antagonist UBP304¡Û	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Inactive isomer of the potent, selective GLUK5 receptor antagonist UBP 304 (#Asc-194).
¡¡	AST	AST-168-10mg	UBP310 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione¡Û	10mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 ¦ÌM at recombinant human GLUA2 (formerly
¡¡	AST	AST-168-50mg	UBP310 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione¡Û	50mg	¾È²ñ	+4¡î	none
	¡¡ ¡¡ ¡¡ GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 ¦ÌM at recombinant human GLUA2 (formerly
·àʪ	AST	AST-309-1mg	UCPH-101 ¡Ú2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile¡Û	1mg	¾È²ñ	+4¡î	1118460-77-7
	¡¡ ¡¡ ¡¡ Potent, selective inhibitor of EAAT1 (IC50 = 0.66 ¦ÌM ). Displays >400-fold selectivity over EAAT2 and EAAT3.
¡¡	AST	AST-309-10mg	UCPH-101 ¡Ú2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile¡Û	10mg	¾È²ñ	+4¡î	1118460-77-7
	¡¡ ¡¡ ¡¡ Potent, selective inhibitor of EAAT1 (IC50 = 0.66 ¦ÌM ). Displays >400-fold selectivity over EAAT2 and EAAT3.
¡¡	AST	AST-175-1mg	(Arg-8)-Vasopressin ¡ÚVasopressin Receptor Agonist¡Û	1mg	¾È²ñ	-20¡î	113-79-1
	¡¡ ¡¡ ¡¡ Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence¡§CYFQNCPRG-NH2 disulfide bridge 1-6
¡¡	AST	AST-175-5mg	(Arg-8)-Vasopressin ¡ÚVasopressin Receptor Agonist¡Û	5mg	¾È²ñ	-20¡î	113-79-1
	¡¡ ¡¡ ¡¡ Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence¡§CYFQNCPRG-NH2 disulfide bridge 1-6
·àʪ	AST	AST-140-1g	Verapamil, HCl ¡ÚL-type Ca2+ Channel Blocker¡Û	1g	¾È²ñ	RT	152-11-4
	¡¡ ¡¡ ¡¡ L-type Ca2+ channel blocker. Antiarrhythmic in vivo.
¡¡	AST	AST-279-10mg	Veratridine	10mg	¾È²ñ	-20¡î	71-62-5
	¡¡ ¡¡ ¡¡ Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.
¡¡	AST	AST-279-50mg	Veratridine	50mg	¾È²ñ	-20¡î	71-62-5
	¡¡ ¡¡ ¡¡ Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.
¡¡	AST	AST-226-5mg	Vincristine Sulfate	5mg	¾È²ñ	-20¡î	2068-78-2
	¡¡ ¡¡ ¡¡ Anticancer agent; microtubule disrupter.
¡¡	AST	AST-226-25mg	Vincristine Sulfate	25mg	¾È²ñ	-20¡î	2068-78-2
	¡¡ ¡¡ ¡¡ Anticancer agent; microtubule disrupter.
¡¡	AST	AST-180-1mg	VIP (6-28) ¡ÚVPAC Antagonist¡Û	1mg	¾È²ñ	-20¡î	69698-54-0
	¡¡ ¡¡ ¡¡ VPAC antagonist. Amino Acids Sequence:FTDNYTRLRKQMAVKKYLNSILN-NH2
¡¡	AST	AST-244-10mg	VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and
¡¡	AST	AST-244-50mg	VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û	50mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and
¡¡	AST	AST-248-10mg	VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û, Na salt	10mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat
¡¡	AST	AST-248-50mg	VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û, Na salt	50mg	¾È²ñ	RT	none
	¡¡ ¡¡ ¡¡ Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat
¡¡	AST	AST-165-10mg	1400W ¡ÚN-(3-(Aminomethyl)benzyl)acetamidine, 2HCl¡Û	10mg	¾È²ñ	+4¡î	180001-34-7
	¡¡ ¡¡ ¡¡ Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 ¦ÌM and 50 ¦ÌM at human iNOS, nNOS and eNOS respectively).
¡¡	AST	AST-165-50mg	1400W ¡ÚN-(3-(Aminomethyl)benzyl)acetamidine, 2HCl¡Û	50mg	¾È²ñ	+4¡î	180001-34-7
	¡¡ ¡¡ ¡¡ Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 ¦ÌM and 50 ¦ÌM at human iNOS, nNOS and eNOS respectively).
¡¡	AST	AST-040-10mg	(S)-Willardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	10mg	¾È²ñ	+4¡î	21416-43-3
	¡¡ ¡¡ ¡¡ Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 ¦ÌM) over hGluR2 (Ki = 0.90 ¦ÌM); hGluR4 (Ki = 8.85 ¦ÌM) and Kainate receptor hGluR5 (Ki = 28.9 ¦ÌM). Produces strong desensitisation.
¡¡	AST	AST-040-50mg	(S)-Willardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û	50mg	¾È²ñ	+4¡î	21416-43-3
	¡¡ ¡¡ ¡¡ Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 ¦ÌM) over hGluR2 (Ki = 0.90 ¦ÌM); hGluR4 (Ki = 8.85 ¦ÌM) and Kainate receptor hGluR5 (Ki = 28.9 ¦ÌM). Produces strong desensitisation.
¡¡	AST	AST-148-1mg	Wortmannin ¡ÚPI3-Kinase Inhibitor¡Û	1mg	¾È²ñ	-20¡î	19545-26-7
	¡¡ ¡¡ ¡¡ Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)
¡¡	AST	AST-148-5mg	Wortmannin ¡ÚPI3-Kinase Inhibitor¡Û	5mg	¾È²ñ	-20¡î	19545-26-7
	¡¡ ¡¡ ¡¡ Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)
¡¡	AST	AST-089-10mg	XE-991, 2HCl ¡Ú10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl¡Û	10mg	¾È²ñ	+4¡î	122955-42-4
	¡¡ ¡¡ ¡¡ Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 ¦ÌM (M-current), 0.71 ¦ÌM (KCNQ 2), 0.75 ¦ÌM (KCNQX 1), >100 ¦ÌM (Kv1.2) and >43 ¦ÌM (Kv4.
¡¡	AST	AST-089-50mg	XE-991, 2HCl ¡Ú10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl¡Û	50mg	¾È²ñ	+4¡î	122955-42-4
	¡¡ ¡¡ ¡¡ Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 ¦ÌM (M-current), 0.71 ¦ÌM (KCNQ 2), 0.75 ¦ÌM (KCNQX 1), >100 ¦ÌM (Kv1.2) and >43 ¦ÌM (Kv4.
¡¡	AST	AST-129-1mg	Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û	1mg	¾È²ñ	+4¡î	146986-50-7
	¡¡ ¡¡ ¡¡ Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.
¡¡	AST	AST-129-10mg	Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û	10mg	¾È²ñ	+4¡î	146986-50-7
	¡¡ ¡¡ ¡¡ Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.
¡¡	AST	AST-129-50mg	Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û	50mg	¾È²ñ	+4¡î	146986-50-7
	¡¡ ¡¡ ¡¡ Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.
¡¡	AST	AST-293-10mg	YM 202074 ¡ÚN-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	10mg	¾È²ñ	+4¡î	299900-83-7
	¡¡ ¡¡ ¡¡ Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.
¡¡	AST	AST-293-50mg	YM 202074 ¡ÚN-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	50mg	¾È²ñ	+4¡î	299900-83-7
	¡¡ ¡¡ ¡¡ Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.
¡¡	AST	AST-015-10mg	YM298198 ¡Ú6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	10mg	¾È²ñ	+4¡î	748758-45-4
	¡¡ ¡¡ ¡¡ Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 ¦ÌM). Orally active analgesic in vivo.
¡¡	AST	AST-015-50mg	YM298198 ¡Ú6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û	50mg	¾È²ñ	+4¡î	748758-45-4
	¡¡ ¡¡ ¡¡ Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 ¦ÌM). Orally active analgesic in vivo.
¡¡	AST	AST-239-1g	Yohimbine, HCl ¡Ú(16¦Á,17¦Á)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl¡Û	1g	¾È²ñ	RT	65-19-0
	¡¡ ¡¡ ¡¡ Selective ¦Á2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human ¦Á2A, ¦Á2B and ¦Á2C receptors respectively).
¡¡	AST	AST-239-5g	Yohimbine, HCl ¡Ú(16¦Á,17¦Á)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl¡Û	5g	¾È²ñ	RT	65-19-0
	¡¡ ¡¡ ¡¡ Selective ¦Á2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human ¦Á2A, ¦Á2B and ¦Á2C receptors respectively).
¡¡	AST	AST-102-10mg	ZD7288 ¡ÚICI D7288¡Û¡Ú4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride¡Û	10mg	¾È²ñ	+4¡î	133059-99-1
	¡¡ ¡¡ ¡¡ Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.
¡¡	AST	AST-102-50mg	ZD7288 ¡ÚICI D7288¡Û¡Ú4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride¡Û	50mg	¾È²ñ	+4¡î	133059-99-1
	¡¡ ¡¡ ¡¡ Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.
¡¡	AST	AST-218-10mg	ZM 241385 ¡Ú4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol¡Û¡ÚPotent, selective A2A Antagonist¡Û	10mg	¾È²ñ	RT	139180-30-6
	¡¡ ¡¡ ¡¡ Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 ¦ÌM at human cloned A2A, A2B, A1 and A3 receptors respectively. O
¡¡	AST	AST-218-50mg	ZM 241385 ¡Ú4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol¡Û¡ÚPotent, selective A2A Antagonist¡Û	50mg	¾È²ñ	RT	139180-30-6
	¡¡ ¡¡ ¡¡ Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 ¦ÌM at human cloned A2A, A2B, A1 and A3 receptors respectively. O
¡¡	AST	AST-076-10mg	Zopiclone ¡Ú4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester¡Û	10mg	¾È²ñ	+4¡î	43200-80-2
	¡¡ ¡¡ ¡¡ Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.
¡¡	AST	AST-076-50mg	Zopiclone ¡Ú4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester¡Û	50mg	¾È²ñ	+4¡î	43200-80-2
	¡¡ ¡¡ ¡¡ Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.