toptop2top3top4top5

¾¦ÉʰìÍ÷



Ë¡Îá¥Ö¥é¥ó¥É¥«¥¿¥í¥°Èֹ澦ÉÊ̾¥µ¥¤¥º²Á³ÊÊݸ²¹Å٣ãÁ£Ó

¡¡ AST AST-287-10mg A23187 ¡ÚCalcium Ionophore¡Û 10mg ¾È²ñ RT 52665-69-7
¡¡
¡¡
¡¡
A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho




¡¡ AST AST-287-50mg A23187 ¡ÚCalcium Ionophore¡Û 50mg ¾È²ñ RT 52665-69-7
¡¡
¡¡
¡¡
A mobile ion-carrier that forms stable complexes with divalent cations. Useful for increasing intracellular Ca2+ levels. Also acts as an uncoupler of oxidative phosphorylation and inhibitor of mitocho




·àʪ AST AST-335-10mg A 769662 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û 10mg ¾È²ñ RT 844499-71-4
¡¡
¡¡
¡¡
Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 ¦ÌM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by




·àʪ AST AST-335-50mg A 769662 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û 50mg ¾È²ñ RT 844499-71-4
¡¡
¡¡
¡¡
Potent, reversible activator of AMP-activated protein kinase (AMPK) (EC50 = 0.8 ¦ÌM). Directly activates native rat AMPK by mimicking the effects of AMP - it activates AMPK both allosterically and by




¡¡ AST AST-282-10mg A 803467 ¡Ú5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide¡Û 10mg ¾È²ñ RT 944261-79-4
¡¡
¡¡
¡¡
Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 ¦ÌM). Shows no significant a




¡¡ AST AST-282-50mg A 803467 ¡Ú5-(4-Chlorophenyl)-N-(3,5-dimethoxyphenyl)-2-furancarboxamide¡Û 50mg ¾È²ñ RT 944261-79-4
¡¡
¡¡
¡¡
Selective blocker of NaV1.8 channels (IC50 = 8 nM for human Nav1.8 ). Shows greater than 100-fold selectivity over human Nav1.2, Nav1.3, Nav1.5, and Nav1.7 (IC50 values =1 ¦ÌM). Shows no significant a




¡¡ AST AST-251-5mg ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û 5mg ¾È²ñ -20¡î 220556-69-4
¡¡
¡¡
¡¡
Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.




¡¡ AST AST-251-25mg ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û 25mg ¾È²ñ -20¡î 220556-69-4
¡¡
¡¡
¡¡
Potent and selective neuronal CB1 cannabinoid receptor agonist ( Ki = 1.4 nM). Displays > 1400-fold selectivity over CB2 receptors. Active in vivo.




¡¡ AST AST-096-5mg ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û in Ethanol Solution 5mg ¾È²ñ -20¡î 220556-69-4
¡¡
¡¡
¡¡
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.




¡¡ AST AST-096-25mg ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û in Ethanol Solution 25mg ¾È²ñ -20¡î 220556-69-4
¡¡
¡¡
¡¡
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.




¡¡ AST AST-096-100mg ACEA ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Chloroethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚPotent, selective CB1 agonist¡Û 100mg ¾È²ñ -20¡î 220556-69-4
¡¡
¡¡
¡¡
Potent and highly selective CB1 receptor agonist (Ki = 1.4 nM). Displays more than 1000-fold selectivity over CB2 receptors. Active in vivo.




¡¡ AST AST-097-10mg ACPA ¡Ú(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide¡Û¡ÚCB1 Agonist¡Û 10mg ¾È²ñ -20¡î 229021-64-1
¡¡
¡¡
¡¡
Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.




¡¡ AST AST-097-50mg ACPA ¡Ú(5Z,8Z,11Z,14Z)-N-Cyclopropylicosa-5,8,11,14-tetraenamide¡Û¡ÚCB1 Agonist¡Û 50mg ¾È²ñ -20¡î 229021-64-1
¡¡
¡¡
¡¡
Potent, selective CB1 agonist (Ki = 2.2 nM), >300-fold selective over CB2 receptors. Active in vivo.




¡¡ AST AST-150-10mg 6,7-ADTN, HBr ¡Ú6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr¡Û¡ÚDopamine Agonist¡Û 10mg ¾È²ñ +4¡î 13575-86-5
¡¡
¡¡
¡¡
Dopamine D1 agonist




¡¡ AST AST-150-50mg 6,7-ADTN, HBr ¡Ú6-Amino-5,6,7,8-tetrahydronaphthalene-2,3-diol, HBr¡Û¡ÚDopamine Agonist¡Û 50mg ¾È²ñ +4¡î 13575-86-5
¡¡
¡¡
¡¡
Dopamine D1 agonist




¡¡ AST AST-152-10mg AF-DX 116 ¡Ú11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û 10mg ¾È²ñ RT 102394-31-0
¡¡
¡¡
¡¡
Selective M2 receptor antagonist.




¡¡ AST AST-152-50mg AF-DX 116 ¡Ú11-[[2-[(Diethylamino)methyl]-1-piperidinyl]acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û 50mg ¾È²ñ RT 102394-31-0
¡¡
¡¡
¡¡
Selective M2 receptor antagonist.




¡¡ AST AST-088-10mg AM 251 ¡Ú1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide¡Û 10mg ¾È²ñ +4¡î 183232-66-8
¡¡
¡¡
¡¡
Cannabinoid CB1 receptor antagonist / inverse agonist




¡¡ AST AST-088-50mg AM 251 ¡Ú1-(2,4-Dichlorophenyl)-5-(4-iodophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide¡Û 50mg ¾È²ñ +4¡î 183232-66-8
¡¡
¡¡
¡¡
Cannabinoid CB1 receptor antagonist / inverse agonist




¡¡ AST AST-095-10mg AM 404 ¡Ú(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚAnandamideTransport Inhibitor¡Û 10mg ¾È²ñ -20¡î 198022-70-7
¡¡
¡¡
¡¡
Competitive and selective anandamide transport inhibitor (IC50 = 1 ¦ÌM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep




¡¡ AST AST-095-50mg AM 404 ¡Ú(5Z,8Z,11Z,14Z)-N-(4-Hydroxyphenyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚAnandamideTransport Inhibitor¡Û 50mg ¾È²ñ -20¡î 198022-70-7
¡¡
¡¡
¡¡
Competitive and selective anandamide transport inhibitor (IC50 = 1 ¦ÌM). Active in vivo. Does not activate CB1 receptors or inhibit anandamide hydrolysis but has been shown to activate vanilloid recep




¡¡ AST AST-281-100mg Amiloride 100mg ¾È²ñ RT 2016-88-8
¡¡
¡¡
¡¡
Epithelial sodium channel (eNaC) blocker. At higher concentrations, blocks the Na+/H+ exchange pathway. Also blocks transient reception potential cation (TRPC6 and TRPP3) channels.




¡¡ AST AST-123-100mg Aminoguanidine, HCl ¡ÚNOS Inhibitor¡Û 100mg ¾È²ñ RT 1937-19-5
¡¡
¡¡
¡¡
Irreversible inhibitor of iNOS, displaying 26-fold selectivity over nNOS. In vitro and in vivo inhibitor of the formation of glycosylation end products associated with diabetes and aging.




¡¡ AST AST-122-100mg 4-Aminopyridine ¡ÚK+ Channel Blocker¡Û 100mg ¾È²ñ RT 504-24-5
¡¡
¡¡
¡¡
Potassium channel blocker. Blocks Kv channels. Convulsant, and useful tool to model epileptiform activity in vitro.




¡¡ AST AST-011-10mg AMN082, 2HCl ¡ÚN,N'-Dibenzhydrylethane-1,2-diamine, 2HCl¡Û 10mg ¾È²ñ +4¡î 03027-13-8
¡¡
¡¡
¡¡
Potent, selective, orally active and brain penetrant mGlu7 receptor agonist




¡¡ AST AST-011-50mg AMN082, 2HCl ¡ÚN,N'-Dibenzhydrylethane-1,2-diamine, 2HCl¡Û 50mg ¾È²ñ +4¡î 03027-13-8
¡¡
¡¡
¡¡
Potent, selective, orally active and brain penetrant mGlu7 receptor agonist




¡¡ AST AST-130-10mg (RS)-AMPA ¡Ú(RS)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û 10mg ¾È²ñ RT 74341-63-2
¡¡
¡¡
¡¡
Prototypic agonist for AMPA receptors.




¡¡ AST AST-130-50mg (RS)-AMPA ¡Ú(RS)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û 50mg ¾È²ñ RT 74341-63-2
¡¡
¡¡
¡¡
Prototypic agonist for AMPA receptors.




¡¡ AST AST-005-5mg (S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û 5mg ¾È²ñ +4¡î 83643-88-3
¡¡
¡¡
¡¡
AMPA agonist




¡¡ AST AST-005-10mg (S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û 10mg ¾È²ñ +4¡î 83643-88-3
¡¡
¡¡
¡¡
AMPA agonist




¡¡ AST AST-005-50mg (S)-AMPA ¡Ú(S)-¦Á-Amino-3-hydroxy-5-methylisoxazole-4-propionic Acid¡Û¡ÚAMPA Agonist¡Û 50mg ¾È²ñ +4¡î 83643-88-3
¡¡
¡¡
¡¡
AMPA agonist




¡¡ AST AST-301-100ug Amyloid ¦Â (1-42) (human) 100ug ¾È²ñ -20¡î 107761-42-2
¡¡
¡¡
¡¡
42-residue amyloid ¦Â-protein fragment; the predominant form of amyloid ¦Â found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac




¡¡ AST AST-301-1mg Amyloid ¦Â (1-42) (human) 1mg ¾È²ñ -20¡î 107761-42-2
¡¡
¡¡
¡¡
42-residue amyloid ¦Â-protein fragment; the predominant form of amyloid ¦Â found in the brains of people with Alzheimer's disease and Down's syndrome. Neurotoxic. Shown to induce neuronal death via ac




¡¡ AST AST-087-5mg Anandamide ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous Cannabinoid¡Û 5mg ¾È²ñ -20¡î 94421-68-8
¡¡
¡¡
¡¡
Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.




¡¡ AST AST-087-25mg Anandamide ¡Ú(5Z,8Z,11Z,14Z)-N-(2-Hydroxyethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous Cannabinoid¡Û 25mg ¾È²ñ -20¡î 94421-68-8
¡¡
¡¡
¡¡
Endogenous cannabinoid, binding to CB1, CB2 and vanilloid receptors. Cannabimimetic in vivo.




¡¡ AST AST-013-1mg (+/-)-Anatoxin A Fumarate ¡Ú(+/-)-2-Acetyl-9-azabicyclo[4.2.1]non-2-ene Fumarate¡Û 1mg ¾È²ñ +4¡î 64285-06-9
¡¡
¡¡
¡¡
Potent nicotinic agonist




¡¡ AST AST-183-5mg Angiotensin II ¡ÚVasoconstrictor Peptide¡Û (human) 5mg ¾È²ñ -20¡î 68521-88-0
¡¡
¡¡
¡¡
Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino




¡¡ AST AST-183-10mg Angiotensin II ¡ÚVasoconstrictor Peptide¡Û (human) 10mg ¾È²ñ -20¡î 68521-88-0
¡¡
¡¡
¡¡
Endogenous peptide involved in body water and electrolyte homeostasis, blood pressure, cyclicity of reproductive hormones and sexual behaviours, and the regulation of pituitary gland hormones. Amino




¡¡ AST AST-316-50mg Aniracetam ¡Ú1-(4-Anisoyl)pyrrolidin-2-one¡Û 50mg ¾È²ñ RT 72432-10-1
¡¡
¡¡
¡¡
Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.




¡¡ AST AST-316-250mg Aniracetam ¡Ú1-(4-Anisoyl)pyrrolidin-2-one¡Û 250mg ¾È²ñ RT 72432-10-1
¡¡
¡¡
¡¡
Nootropic, positive allosteric modulator of AMPA receptors. Slows AMPA receptor deactivation and desensitisation. Antidpressant and anxiolytic in vivo.




¡¡ AST AST-001-100mg DL-AP4 ¡ÚDL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚNMDA receptor Antagonist¡Û 100mg ¾È²ñ +4¡î 20263-07-4
¡¡
¡¡
¡¡
Selective group III mGlu receptor agonist




¡¡ AST AST-001-1g DL-AP4 ¡ÚDL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚNMDA receptor Antagonist¡Û 1g ¾È²ñ +4¡î 20263-07-4
¡¡
¡¡
¡¡
Selective group III mGlu receptor agonist




¡¡ AST AST-002-10mg L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û 10mg ¾È²ñ +4¡î 23052-81-5
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist




¡¡ AST AST-002-50mg L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û 50mg ¾È²ñ +4¡î 23052-81-5
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist




¡¡ AST AST-253-100mg L-AP4 ¡ÚL-2-Amino-4-phosphonobutyric Acid¡Û¡ÚSelective group III mGlu Agonist¡Û, Na salt 100mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Broad spectrum receptor antagonist - water soluble form.




¡¡ AST AST-271-10mg DL-AP5 ¡ÚDL-2-Amino-5-phosphonopentanoic Acid¡Û, Na salt 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist. Water soluble form.




¡¡ AST AST-271-50mg DL-AP5 ¡ÚDL-2-Amino-5-phosphonopentanoic Acid¡Û, Na salt 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist. Water soluble form.




¡¡ AST AST-003-10mg D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û 10mg ¾È²ñ +4¡î 79055-68-8
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist




¡¡ AST AST-003-50mg D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û 50mg ¾È²ñ +4¡î 79055-68-8
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist




¡¡ AST AST-003-100mg D-AP5 ¡ÚD-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û 100mg ¾È²ñ +4¡î 79055-68-8
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist




¡¡ AST AST-268-500ug Apamin 500ug ¾È²ñ -20¡î 24345-16-2
¡¡
¡¡
¡¡
Peptide neurotoxin that naturally occurs in Apis mellifera bee venom. Blocks small conductance Ca2+ activated K+ channels (SK). Selective for KCa2.1-2.3 (SK1-3) isoforms. Blocks hSK1, rSK2 and liver r




¡¡ AST AST-124-100mg 2-APB ¡Ú2-Aminoethyl Diphenyl Borinate¡Û¡ÚCa2+ Release Modulator¡Û 100mg ¾È²ñ +4¡î 524-95-8
¡¡
¡¡
¡¡
Cell permeable, allosteric inhibitor of D-myo-inositol 1,4,5-trisphosphate (IP3) -induced Ca2+ release . Inhibits IP3-induced Cat2+ release without affecting IP3 receptor binding. Blocks store operate




¡¡ AST AST-141-10mg Apigenin ¡Ú4,5,7-Trihydroxyflavone¡Û 10mg ¾È²ñ +4¡î 520-36-5
¡¡
¡¡
¡¡
Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-¦ÊB.




¡¡ AST AST-141-50mg Apigenin ¡Ú4,5,7-Trihydroxyflavone¡Û 50mg ¾È²ñ +4¡î 520-36-5
¡¡
¡¡
¡¡
Plant flavone. Anti-oxidant, anti-inflammatory and anticancer properties. Effects a wide range of molecular targets including caspases, fatty acid synthase, topoisomerase and nuclear factor-¦ÊB.




¡¡ AST AST-151-10mg AQ-RA 741 ¡Ú11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û 10mg ¾È²ñ RT 123548-16-3
¡¡
¡¡
¡¡
Potent, selective M2 receptor antagonist.




¡¡ AST AST-151-50mg AQ-RA 741 ¡Ú11-({4-[4-(Diethylamino)butyl]-1-piperidinyl}acetyl)-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one¡Û¡ÚM2 Antagonist¡Û 50mg ¾È²ñ RT 123548-16-3
¡¡
¡¡
¡¡
Potent, selective M2 receptor antagonist.




·àʪ AST AST-098-5mg 2-Arachidonoylglycerol in Acetontrile 5mg ¾È²ñ -20¡î 53847-30-6
¡¡
¡¡
¡¡
Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.




·àʪ AST AST-098-25mg 2-Arachidonoylglycerol in Acetontrile 25mg ¾È²ñ -20¡î 53847-30-6
¡¡
¡¡
¡¡
Endogenous CB1 and CB2 cannabinoid receptor agonist (Ki values are 472 nM and 1400 nM respectively). Found in the brain at concentrations 1000-fold higher than that of anandamide.




¡¡ AST AST-004-10mg DL-ASP5 ¡ÚDL-(-)-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û 10mg ¾È²ñ +4¡î 76326-31-3
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist.




¡¡ AST AST-004-50mg DL-ASP5 ¡ÚDL-(-)-2-Amino-5-phosphonopentanoic Acid¡Û¡ÚNMDA Glutamate site Antagonist¡Û 50mg ¾È²ñ +4¡î 76326-31-3
¡¡
¡¡
¡¡
Competitive NMDA receptor glutamate site antagonist.




¡¡ AST AST-179-1mg AY-NH2 ¡ÚPAR4 Agonist Peptide¡Û 1mg ¾È²ñ -20¡î 352017-71-1
¡¡
¡¡
¡¡
Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2




¡¡ AST AST-179-5mg AY-NH2 ¡ÚPAR4 Agonist Peptide¡Û 5mg ¾È²ñ -20¡î 352017-71-1
¡¡
¡¡
¡¡
Proteinase-activated receptor-4 activating (PAR4) agonist peptide. Proinflammatory, coagulating and analgesic effects. Amino Acids Sequence:AYPGKF-NH2




¡¡ AST AST-149-1g (RS)-Baclofen ¡Ú(R,S)-4-Amino-3-(4-chlorophenyl)butanoic Acid¡Û¡ÚGABAB Agonist¡Û 1g ¾È²ñ RT 1134-47-0
¡¡
¡¡
¡¡
Selective GABAB receptor agonist. Antispasmodic.




¡¡ AST AST-178-1mg BAM (8-22) ¡ÚSNSR Agonist¡Û 1mg ¾È²ñ -20¡î 412961-36-5
¡¡
¡¡
¡¡
Endogenous peptide fragment that is a selective agonist for the sensory neuron specific receptor (EC50 values are 28 and 14 nM for SNSR3 and SNSR4 respectively). Inhibits development of morphine toler




¡¡ AST AST-107-50mg (+)-Bicuculline ¡Ú(S)-6-((S)-5,6,7,8-Tetrahydro-6-methyl-[1,3]dioxolo[4,5-g]isoquinolin-5-yl)isobenzofuro[4,5-d][1,3]dioxol-8(6H)-one¡Û¡ÚGABAA Antagonist.¡Û 50mg ¾È²ñ +4¡î 485-49-4
¡¡
¡¡
¡¡
GABAA antagonist.




¡¡ AST AST-108-10mg (-)-Bicuculline Methiodide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide¡Û¡ÚGABAA Antagonist¡Û 10mg ¾È²ñ +4¡î 55950-07-7
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-108-50mg (-)-Bicuculline Methiodide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Iodide¡Û¡ÚGABAA Antagonist¡Û 50mg ¾È²ñ +4¡î 55950-07-7
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methiodide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-109-10mg (-)-Bicuculline Methobromide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide¡Û¡ÚGABAA Antagonist¡Û 10mg ¾È²ñ +4¡î 73604-30-5
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-109-50mg (-)-Bicuculline Methobromide ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Bromide¡Û¡ÚGABAA Antagonist¡Û 50mg ¾È²ñ +4¡î 73604-30-5
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methobromide salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-110-10mg (-)-Bicuculline Methochloride ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride¡Û¡ÚGABAA Antagonist¡Û 10mg ¾È²ñ +4¡î 53552-05-9
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-110-50mg (-)-Bicuculline Methochloride ¡Ú[S-(R*,S*)]-5-(6,8-Dihydro-8-oxofuro[3,4-e]-1,3-benzodioxol-6-yl)-5,6,7,8-tetrahydro-6,6-dimethyl-1,3-dioxolo[4,5-g]isoquinolinium Chloride¡Û¡ÚGABAA Antagonist¡Û 50mg ¾È²ñ +4¡î 53552-05-9
¡¡
¡¡
¡¡
Water-soluble GABAA antagonist. Methochloride salt of (+)-bicuculline (Asc-107). Actions on neuronal Ca2+-activated K+ channels reported.




¡¡ AST AST-299-5mg Brefeldin A 5mg ¾È²ñ -20¡î 20350-15-6
¡¡
¡¡
¡¡
Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, ¦Â-COP and ADP-ribosylation factor (ARF) to Golgi m




¡¡ AST AST-299-25mg Brefeldin A 25mg ¾È²ñ -20¡î 20350-15-6
¡¡
¡¡
¡¡
Reversible inhibitor of protein translocation from the endoplasmic reticulum to the Golgi apparatus. Inhibits binding of the cytosolic coat protein, ¦Â-COP and ADP-ribosylation factor (ARF) to Golgi m




¡¡ AST AST-240-1g Caffeine ¡Ú1,3,7-Trimethylxanthine¡Û¡ÚPDE Inhibitor¡Û¡ÚAdenosine Antagonist¡Û 1g ¾È²ñ RT 58-08-2
¡¡
¡¡
¡¡
Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.




¡¡ AST AST-240-5g Caffeine ¡Ú1,3,7-Trimethylxanthine¡Û¡ÚPDE Inhibitor¡Û¡ÚAdenosine Antagonist¡Û 5g ¾È²ñ RT 58-08-2
¡¡
¡¡
¡¡
Psychostimulant. Adenosine A1 and A2A receptor antagonist. Involved in the mobilization of intracellular calcium and the inhibition of cAMP phosphodiesterases.




¡¡ AST AST-115-50mg Camptothecin ¡Ú(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione¡Û¡ÚDNA Topoisomerase Inhibitor¡Û 50mg ¾È²ñ +4¡î 7689-03-4
¡¡
¡¡
¡¡
Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.




¡¡ AST AST-115-250mg Camptothecin ¡Ú(S)-4-Ethyl-4-hydroxy-1H-pyrano-[3'4':6,7] indolizino[1,2-b]quinoline-3,14(4H,12H)-dione¡Û¡ÚDNA Topoisomerase Inhibitor¡Û 250mg ¾È²ñ +4¡î 7689-03-4
¡¡
¡¡
¡¡
Cell permeable DNA topoisomerase inhibitor. Potent anti-tumour and antibiotic agent.




¡¡ AST AST-025-10mg Capsazepine ¡ÚVR1 Vanilloid Receptor Antagonist¡Û 10mg ¾È²ñ +4¡î 138977-28-3
¡¡
¡¡
¡¡
VR1 vanilloid receptor antagonist




¡¡ AST AST-025-50mg Capsazepine ¡ÚVR1 Vanilloid Receptor Antagonist¡Û 50mg ¾È²ñ +4¡î 138977-28-3
¡¡
¡¡
¡¡
VR1 vanilloid receptor antagonist




¡¡ AST AST-209-1mg CCK Octapeptide Sulfated 1mg ¾È²ñ -20¡î 25126-32-3
¡¡
¡¡
¡¡
Endogenous C-terminal octapeptide of CCK involved in the neurobiology of anxiety, depression, psychosis, cognition, nociception and feeding behavior.




¡¡ AST AST-012-10mg CGP 37157 ¡Ú7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one¡Û¡ÚNa+-Ca2+ Exchange Inhibitor¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger




¡¡ AST AST-012-50mg CGP 37157 ¡Ú7-Chloro-5-(2-chlorophenyl)-1,2,3,5-tetrahydro-4,1-benzothiazepine-2-one¡Û¡ÚNa+-Ca2+ Exchange Inhibitor¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective inhibitor of the mitochondrial Na+-Ca2+ exchanger




¡¡ AST AST-127-10mg CGP 37849 ¡Ú(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û 10mg ¾È²ñ +4¡î 127910-31-0
¡¡
¡¡
¡¡
Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.




¡¡ AST AST-127-50mg CGP 37849 ¡Ú(E)-(+/-)-2-Amino-4-methyl-5-phosphono-3-pentenoic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û 50mg ¾È²ñ +4¡î 127910-31-0
¡¡
¡¡
¡¡
Competitive NMDA receptor antagonist (Ki = 35 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.




¡¡ AST AST-128-10mg CGP 39551 ¡Ú(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û 10mg ¾È²ñ +4¡î 127910-32-1
¡¡
¡¡
¡¡
Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.




¡¡ AST AST-128-50mg CGP 39551 ¡Ú(E)-4-(ethoxycarbonyl)-4-amino-2-methylbut-2-enylphosphonic Acid¡Û¡ÚCompetitive NMDA Antagonist¡Û 50mg ¾È²ñ +4¡î 127910-32-1
¡¡
¡¡
¡¡
Competitive NMDA receptor antagonist (Ki = 310 nM for displacement of CPP binding in rat brain). Potent oral anticonvulsant activity in vivo.




¡¡ AST AST-269-10ug Charybdotoxin 10ug ¾È²ñ -20¡î 95751-30-7
¡¡
¡¡
¡¡
Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC




¡¡ AST AST-269-100ug Charybdotoxin 100ug ¾È²ñ -20¡î 95751-30-7
¡¡
¡¡
¡¡
Blocks KCa1.1 (large conductance Ca2+ activated K+, Slo) channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Amino Acids Sequence:Pyr-FTNVSCTTSKECWSVC




¡¡ AST AST-037-10mg 2-Chloroadenosine ¡ÚAdenosine Agonist¡Û 10mg ¾È²ñ +4¡î 146-77-0
¡¡
¡¡
¡¡
Adenosine receptor agonist




¡¡ AST AST-037-50mg 2-Chloroadenosine ¡ÚAdenosine Agonist¡Û 50mg ¾È²ñ +4¡î 146-77-0
¡¡
¡¡
¡¡
Adenosine receptor agonist




¡¡ AST AST-037-250mg 2-Chloroadenosine ¡ÚAdenosine Agonist¡Û 250mg ¾È²ñ +4¡î 146-77-0
¡¡
¡¡
¡¡
Adenosine receptor agonist




¡¡ AST AST-024-10mg 7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û 10mg ¾È²ñ +4¡î 18000-24-3
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist




¡¡ AST AST-024-50mg 7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û 50mg ¾È²ñ +4¡î 18000-24-3
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist




¡¡ AST AST-255-10mg 7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û, Na salt 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist. Water soluble form.




¡¡ AST AST-255-50mg 7-Chlorokynurenic Acid ¡Ú7-Chloro-4-hydroxyquinoline-2-carboxylic Acid¡Û¡ÚNMDA Receptor Glycine site Antagonist¡Û, Na salt 50mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist. Water soluble form.




¡¡ AST AST-039-10mg (RS)-CHPG ¡Ú(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid¡Û¡ÚSelective mGlu5 Agonist¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective mGlu5 receptor agonist




¡¡ AST AST-039-50mg (RS)-CHPG ¡Ú(R,S)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic Acid¡Û¡ÚSelective mGlu5 Agonist¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective mGlu5 receptor agonist




¡¡ AST AST-221-10mg (RS)-CHPG, Na salt ¡Ú(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic £Ácid, Na salt¡Û¡ÚmGlu5 Agonist¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist




¡¡ AST AST-221-50mg (RS)-CHPG, Na salt ¡Ú(RS)-2-Amino-2-(2-chloro-5-hydroxyphenyl)acetic £Ácid, Na salt¡Û¡ÚmGlu5 Agonist¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble form of (RS)-CHPG (#Asc-039), a selective mGlu5 agonist




·àʪ AST AST-133-25mg Citalopram ¡Ú1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr¡Û¡Ú5HT Reuptake Inhibitor¡Û 25mg ¾È²ñ RT 59729-32-7
¡¡
¡¡
¡¡
Selective serotonin reuptake inhibitor. Antidepressant in vivo.




·àʪ AST AST-133-100mg Citalopram ¡Ú1-[3-(Dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofurancarbonitrile, HBr¡Û¡Ú5HT Reuptake Inhibitor¡Û 100mg ¾È²ñ RT 59729-32-7
¡¡
¡¡
¡¡
Selective serotonin reuptake inhibitor. Antidepressant in vivo.




¡¡ AST AST-019-50mg Clozapine ¡Ú(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û 50mg ¾È²ñ +4¡î 5786-21-0
¡¡
¡¡
¡¡
A typical antipsychotic compound.




¡¡ AST AST-019-500mg Clozapine ¡Ú(8-Chloro-11-(4-methyl-1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û 500mg ¾È²ñ +4¡î 5786-21-0
¡¡
¡¡
¡¡
A typical antipsychotic compound.




·àʪ AST AST-017-10mg CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û 10mg ¾È²ñ +4¡î 115066-14-3
¡¡
¡¡
¡¡
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.




·àʪ AST AST-017-25mg CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û 25mg ¾È²ñ +4¡î 115066-14-3
¡¡
¡¡
¡¡
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.




·àʪ AST AST-017-50mg CNQX ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione¡Û 50mg ¾È²ñ +4¡î 115066-14-3
¡¡
¡¡
¡¡
Potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.




·àʪ AST AST-044-10mg CNQX, 2Na salt ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.




·àʪ AST AST-044-50mg CNQX, 2Na salt ¡Ú6-Cyano-7-nitroquinoxaline-2,3-dione, 2Na salt¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble, potent, competitive AMPA / kainate receptor antagonist. Also antagonist at NMDA receptor glycine site.




¡¡ AST AST-215 ¦Ø-Conotoxin GVIA - - - only Information ¾È²ñ -20¡î 106375-28-4
¡¡
¡¡
¡¡
Synthetic toxin originally isolated from Conus geographus. Specific blocker of Cav2.2 (N-type) Ca2+ channels. Binds to the Cav2.2¦Á1 subunit (¦Á1B) and its action is only partially reversible.




¡¡ AST AST-216 ¦Ø-Conotoxin MVIIA - - - only Information ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
Synthetic peptidyl toxin originally isolated from Conus magus snail venom. Specifically blocks Cav2.2 (¦Á1B, N-type) channels.




¡¡ AST AST-211 ¦Ø-Conotoxin MVIIC - - - only Information ¾È²ñ -20¡î 147794-23-8
¡¡
¡¡
¡¡
Blocker of voltage-gated Ca2+ channels (P and Q)




¡¡ AST AST-060-10mg CPCCOEt ¡Ú(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate¡Û 10mg ¾È²ñ +4¡î 179067-99-3
¡¡
¡¡
¡¡
Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist




¡¡ AST AST-060-50mg CPCCOEt ¡Ú(E)-Ethyl 1,1a,7,7a-tetrahydro-7-(hydroxyimino)cyclopropa[b]chromene-1a-carboxylate¡Û 50mg ¾È²ñ +4¡î 179067-99-3
¡¡
¡¡
¡¡
Potent, selective non-competitive mGlu1 metabotropic glutamate receptor antagonist




¡¡ AST AST-159-10mg (R)-CPP ¡Ú(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid¡Û 10mg ¾È²ñ RT 126453-07-4
¡¡
¡¡
¡¡
Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 ¦ÌM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.




¡¡ AST AST-159-50mg (R)-CPP ¡Ú(R)-3-(2-Carboxypiperazin-4-yl)propyl-1-phosphonic Acid¡Û 50mg ¾È²ñ RT 126453-07-4
¡¡
¡¡
¡¡
Highly potent, competitive NMDA antagonist; more active enantiomer of (RS)-CPP (#Asc-160). Ki values are 0.04, 0.3, 0.6 and 2.0 ¦ÌM at NR1/NR2A, NR1/NR2B, NR1/NR2C and NR1/NR2D respectively.




·àʪ AST AST-093-100mg Cycloheximide ¡Ú3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide¡Û¡ÚProtein Synthesis Inhibitor¡Û 100mg ¾È²ñ +4¡î 66-81-9
¡¡
¡¡
¡¡
Protein synthesis inhibitor. Antifungal antibiotic.




·àʪ AST AST-093-1g Cycloheximide ¡Ú3-[2-(3,5-Dimethyl-2-oxocyclohexyl)-2-hydroxyethyl]glutarimide¡Û¡ÚProtein Synthesis Inhibitor¡Û 1g ¾È²ñ +4¡î 66-81-9
¡¡
¡¡
¡¡
Protein synthesis inhibitor. Antifungal antibiotic.




¡¡ AST AST-300-10mg Cyclopiazonic Acid from Penicillium grisefulvum 10mg ¾È²ñ -20¡î 18172-33-3
¡¡
¡¡
¡¡
Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.




¡¡ AST AST-300-50mg Cyclopiazonic Acid from Penicillium grisefulvum 50mg ¾È²ñ -20¡î 18172-33-3
¡¡
¡¡
¡¡
Cell-permeable, reversible inhibitor of sarcoplasmic reticulum Ca2+-ATPase.




¡¡ AST AST-121-50mg D-Cycloserine ¡Ú(R)-4-Aminoisoxazolidin-3-one¡Û¡ÚNMDA Glycine site Agonist¡Û 50mg ¾È²ñ -20¡î 68-41-7
¡¡
¡¡
¡¡
Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.




¡¡ AST AST-121-250mg D-Cycloserine ¡Ú(R)-4-Aminoisoxazolidin-3-one¡Û¡ÚNMDA Glycine site Agonist¡Û 250mg ¾È²ñ -20¡î 68-41-7
¡¡
¡¡
¡¡
Partial agonist at the NMDA receptor glycine recognition site. Enhances learning and memory in vivo. Perfomance enhancer in a variety of cognitive models.




¡¡ AST AST-114-25mg Cyclosporin A ¡ÚPP2B Inhibitor¡Û 25mg ¾È²ñ -20¡î 59865-13-3
¡¡
¡¡
¡¡
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).




¡¡ AST AST-114-100mg Cyclosporin A ¡ÚPP2B Inhibitor¡Û 100mg ¾È²ñ -20¡î 59865-13-3
¡¡
¡¡
¡¡
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).




¡¡ AST AST-114-250mg Cyclosporin A ¡ÚPP2B Inhibitor¡Û 250mg ¾È²ñ -20¡î 59865-13-3
¡¡
¡¡
¡¡
Immunosuppressant. Complexes with cyclophilin to inhibit the phosphatase activity of calcineurin (PP2B).




¡¡ AST AST-061-10mg Cyclothiazide ¡Ú6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide¡Û 10mg ¾È²ñ +4¡î 2259-96-3
¡¡
¡¡
¡¡
Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.




¡¡ AST AST-061-50mg Cyclothiazide ¡Ú6-Chloro-3,4-dihydro-3-(norbornen-5-yl)-2H-1,2,4-benzothiadiazine-7-sulfonamide-1,1-dioxide¡Û 50mg ¾È²ñ +4¡î 2259-96-3
¡¡
¡¡
¡¡
Positive allosteric modulator of AMPA receptors. Produces a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current.




¡¡ AST AST-220-10mg D4476 ¡Ú4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide¡Û¡ÚCK1 Inhibitor¡Û 10mg ¾È²ñ +4¡î 301836-43-1
¡¡
¡¡
¡¡
Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 ¦ÌM for CK1, ALK5, PKD1 and p38¦ÁMAPK respectively. Displays selectivity over many other protein kin




¡¡ AST AST-220-50mg D4476 ¡Ú4-[4-(2,3-Dihydro-1,4-benzodioxin-6-yl)-5-(2-pyridinyl) -1H-imidazol-2-yl]benzamide¡Û¡ÚCK1 Inhibitor¡Û 50mg ¾È²ñ +4¡î 301836-43-1
¡¡
¡¡
¡¡
Selective cell permeable inhibitor of casein kinase 1 (CK1) . IC50 values are 0.3, 0.5, 9.1 and 5.8 ¦ÌM for CK1, ALK5, PKD1 and p38¦ÁMAPK respectively. Displays selectivity over many other protein kin




¡¡ AST AST-144-25mg 4-DAMP ¡Ú4-Diphenylacetoxy-N-methylpiperidine Methiodide¡Û¡ÚMuscarinic Receptor Antagonist¡Û 25mg ¾È²ñ RT 1952-15-4
¡¡
¡¡
¡¡
Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.




¡¡ AST AST-144-100mg 4-DAMP ¡Ú4-Diphenylacetoxy-N-methylpiperidine Methiodide¡Û¡ÚMuscarinic Receptor Antagonist¡Û 100mg ¾È²ñ RT 1952-15-4
¡¡
¡¡
¡¡
Muscarinic antagonist. Ki values are 0.57, 7.3, 0.37, 0.72 and 0.55 at human M1, M2, M3, M4, and M5 receptors respectively.




¡¡ AST AST-006-10mg (S)-3,4-DCPG ¡ÚUBP1109¡Û¡Ú(S)-3,4-Dicarboxyphenylglycine¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.




¡¡ AST AST-006-50mg (S)-3,4-DCPG ¡ÚUBP1109¡Û¡Ú(S)-3,4-Dicarboxyphenylglycine¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent, selective mGlu8a agonist (EC50 = 31 nM). Displays > 100-fold selectivity over mGlu1-7. Systemically active in vivo.




¡¡ AST AST-026-10mg N-Desmethylclozapine ¡ÚNormethylclozapine¡Û¡Ú8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û 10mg ¾È²ñ +4¡î 6104-71-8
¡¡
¡¡
¡¡
Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist




¡¡ AST AST-026-50mg N-Desmethylclozapine ¡ÚNormethylclozapine¡Û¡Ú8-Chloro-11-(1-piperazinyl)-5H-dibenzo[b,e][1,4]diazepine¡Û 50mg ¾È²ñ +4¡î 6104-71-8
¡¡
¡¡
¡¡
Brain penetrant metabolite of the atypical antipsychotic clozapine. Broad range of actions. Potent allosteric M1 partial agonist (IC50 =55 nM for inhibition of [3H]-NMS binding). D2/D3 partial agonist




¡¡ AST AST-016-10mg Desmethyl YM298198 ¡Ú6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Derivative of mGlu1 antagonist YM298198 (#Asc-015)




¡¡ AST AST-016-50mg Desmethyl YM298198 ¡Ú6-Amino-N-cyclohexyl-3-methylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Derivative of mGlu1 antagonist YM298198 (#Asc-015)




¡¡ AST AST--307-50mg ¦Ã-DGG ¡Ú(R)-4-(Carboxymethylcarbamoyl)-2-aminobutanoic Acid¡Û 50mg ¾È²ñ +4¡î 6729-55-1
¡¡
¡¡
¡¡
Ionotropic glutamate receptor antagonist that has been used as a rapidly dissociating, low affinity competitive antagonist at AMPA receptors.




¡¡ AST AST-020-10mg (R,S)-3,5-DHPG ¡Ú2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid¡Û 10mg ¾È²ñ +4¡î 19641-83-9
¡¡
¡¡
¡¡
Selective group I mGlu receptor agonist




¡¡ AST AST-020-50mg (R,S)-3,5-DHPG ¡Ú2-Amino-2-(3,5-dihydroxyphenyl)acetic Acid¡Û 50mg ¾È²ñ +4¡î 19641-83-9
¡¡
¡¡
¡¡
Selective group I mGlu receptor agonist




¡¡ AST AST-007-5mg (S)-3,5-DHPG ¡Ú(S)-3,5-Dihydroxyphenylglycine¡Û 5mg ¾È²ñ +4¡î 162870-29-3
¡¡
¡¡
¡¡
Selective group I mGlu agonist.




¡¡ AST AST-007-10mg (S)-3,5-DHPG ¡Ú(S)-3,5-Dihydroxyphenylglycine¡Û 10mg ¾È²ñ +4¡î 162870-29-3
¡¡
¡¡
¡¡
Selective group I mGlu agonist.




¡¡ AST AST-266-100mg Diazoxide ¡Ú7-Chloro-3-methyl-2H-1,2,4-benzothiadiazine 1,1-Dioxide¡Û 100mg ¾È²ñ RT 364-98-7
¡¡
¡¡
¡¡
Selective KIR6.x (ATP-sensitive K+ channel) activator; antihypertensive.




¡¡ AST AST-023-10mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û 10mg ¾È²ñ +4¡î 131123-76-7
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist.




¡¡ AST AST-023-50mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û 50mg ¾È²ñ +4¡î 131123-76-7
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist.




¡¡ AST AST-023-100mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û 100mg ¾È²ñ +4¡î 131123-76-7
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist.




¡¡ AST AST-254-10mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist. Water soluble form.




¡¡ AST AST-254-50mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt 50mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist. Water soluble form.




¡¡ AST AST-254-100mg 5,7-Dichlorokynurenic Acid ¡Ú5,7-Dichloro-4-hydroxyquinoline-2-carboxylic Acid¡Û, Na salt 100mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent NMDA receptor glycine site antagonist. Water soluble form.




¡¡ AST AST-066-10mg Dihydrokainic Acid ¡ÚDihydrokainate¡Û¡Ú(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid¡Û 10mg ¾È²ñ +4¡î 52497-36-6
¡¡
¡¡
¡¡
Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 ¦ÌM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).




¡¡ AST AST-066-50mg Dihydrokainic Acid ¡ÚDihydrokainate¡Û¡Ú(2S,3S,4R)-3-(Carboxymethyl)-4-isopropylpyrrolidine-2-carboxylic Acid¡Û 50mg ¾È²ñ +4¡î 52497-36-6
¡¡
¡¡
¡¡
Selective, non-transportable inhibitor of glutamate transporter EAAT2 (Ki = 23 ¦ÌM). 130-fold selective over EAAT1 and EAAT3 (Ki > 3 mM).




¡¡ AST AST-260-1g Diltiazem 1g ¾È²ñ RT 33286-22-5
¡¡
¡¡
¡¡
L-type Ca2+ channel antagonist. Coronary vasodilator.




¡¡ AST AST-018-10mg DNQX ¡Ú6,7-Dinitroquinoxaline-2,3-dione¡Û 10mg ¾È²ñ +4¡î 2379-57-9
¡¡
¡¡
¡¡
AMPA / Kainate antagonist




¡¡ AST AST-018-50mg DNQX ¡Ú6,7-Dinitroquinoxaline-2,3-dione¡Û 50mg ¾È²ñ +4¡î 2379-57-9
¡¡
¡¡
¡¡
AMPA / Kainate antagonist




¡¡ AST AST-169-10mg DNQX, 2Na salt ¡Ú6,7-Dinitroquinoxaline-2,3-dione, 2Na salt¡Û¡ÚAMPA / Kainate Antagonist¡Û 10mg ¾È²ñ +4¡î 2379-57-9
¡¡
¡¡
¡¡
Water soluble, AMPA / kainate antagonist




¡¡ AST AST-169-50mg DNQX, 2Na salt ¡Ú6,7-Dinitroquinoxaline-2,3-dione, 2Na salt¡Û¡ÚAMPA / Kainate Antagonist¡Û 50mg ¾È²ñ +4¡î 2379-57-9
¡¡
¡¡
¡¡
Water soluble, AMPA / kainate antagonist




·àʪ AST AST-166-10mg DPN ¡Ú2,3-Bis(4-hydroxyphenyl)propionitrile¡Û¡ÚPotent, selective ER¦Â Agonist¡Û 10mg ¾È²ñ -20¡î 1428-67-7
¡¡
¡¡
¡¡
Potent, selective ER¦Â agonist (EC50 values are 0.85 and 66 nM for ER¦Â and ER¦Á respectively). Cardioprotective and neuroprotective in vivo.




·àʪ AST AST-166-50mg DPN ¡Ú2,3-Bis(4-hydroxyphenyl)propionitrile¡Û¡ÚPotent, selective ER¦Â Agonist¡Û 50mg ¾È²ñ -20¡î 1428-67-7
¡¡
¡¡
¡¡
Potent, selective ER¦Â agonist (EC50 values are 0.85 and 66 nM for ER¦Â and ER¦Á respectively). Cardioprotective and neuroprotective in vivo.




¡¡ AST AST-192-10mg Dynasore ¡Ú3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate¡Û¡ÚCell permeable Dynamin Inhibitor¡Û 10mg ¾È²ñ -20¡î 304448-55-3
¡¡
¡¡
¡¡
Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.




¡¡ AST AST-192-50mg Dynasore ¡Ú3-Hydroxynaphthalene-2-carboxylic Acid, (3,4-Dihydroxybenzylidene)hydrazide Monohydrate¡Û¡ÚCell permeable Dynamin Inhibitor¡Û 50mg ¾È²ñ -20¡î 304448-55-3
¡¡
¡¡
¡¡
Cell permeable dynamin inhibitor, that blocks endocytosis. Non-competitively inhibits dynamin1, dynamin2 and mitochondrial dynamin GTPase activity. Selective over other small GTPases.




¡¡ AST AST-258-10mg 1-EBIO ¡Ú1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one¡Û 10mg ¾È²ñ RT 10045-45-1
¡¡
¡¡
¡¡
Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.




¡¡ AST AST-258-50mg 1-EBIO ¡Ú1-Ethyl-1,3-dihydro-2H-benzimidazol-2-one¡Û 50mg ¾È²ñ RT 10045-45-1
¡¡
¡¡
¡¡
Activator of small and intermediate conductance Ca2+ activated K+ channels (SK). Also activates apical membrane Cl- conductance CFTR channel.




¡¡ AST AST-158-10mg E-4031, 2HCl ¡ÚN-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide¡Û¡ÚHERG K+ Channel Blocker¡Û 10mg ¾È²ñ +4¡î 113559-13-0
¡¡
¡¡
¡¡
Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl




¡¡ AST AST-158-50mg E-4031, 2HCl ¡ÚN-[4-[{1-[2-(6-Methyl-2-pyridinyl)ethyl]-4-piperidinyl]carbonyl}phenyl]methanesulfonamide¡Û¡ÚHERG K+ Channel Blocker¡Û 50mg ¾È²ñ +4¡î 113559-13-0
¡¡
¡¡
¡¡
Type III anti-arrhythmic drug that blocks ion channels encoded by the ether-a-go-go related gene (ERG1 or KCNH1). Blocks channels in the open configuration with little effect on the channels in the cl




¡¡ AST AST-328-10mg EMD 386088, HCl ¡Ú5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl¡Û 10mg ¾È²ñ RT 54635-62-0
¡¡
¡¡
¡¡
Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D




¡¡ AST AST-328-50mg EMD 386088, HCl ¡Ú5-Chloro-2-methyl-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-Indole, HCl¡Û 50mg ¾È²ñ RT 54635-62-0
¡¡
¡¡
¡¡
Potent 5HT6 agonist (IC50=7.4 nM in 3H-LSD binding and EC50=1.0 nM in a functional cAMP assay). Selective over other 5-HT receptors (IC50 values are 110, 180, 240, 450, 620, 660 and 3000 nM for 5-HT1D




¡¡ AST AST-311-10mg Etomidate ¡ÚEthyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate¡Û 10mg ¾È²ñ RT 33125-97-2
¡¡
¡¡
¡¡
Agonist at GABAA receptors containing ¦Â3 subunits. Anaesthetic and amnesic properties.




¡¡ AST AST-311-50mg Etomidate ¡ÚEthyl 1-((R)-1-Phenylethyl)-1H-imidazole-5-carboxylate¡Û 50mg ¾È²ñ RT 33125-97-2
¡¡
¡¡
¡¡
Agonist at GABAA receptors containing ¦Â3 subunits. Anaesthetic and amnesic properties.




¡¡ AST AST-227-25mg Etoposide ¡ÚTopoisomerase II Inhibitor¡Û 25mg ¾È²ñ RT 33419-42-0
¡¡
¡¡
¡¡
Topoisomerase II inhibitor. Anticancer agent.




¡¡ AST AST-227-100mg Etoposide ¡ÚTopoisomerase II Inhibitor¡Û 100mg ¾È²ñ RT 33419-42-0
¡¡
¡¡
¡¡
Topoisomerase II inhibitor. Anticancer agent.




¡¡ AST AST-214-0.5mg Exendin-4 0.5mg ¾È²ñ -20¡î 141758-74-9
¡¡
¡¡
¡¡
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2




¡¡ AST AST-214-1mg Exendin-4 1mg ¾È²ñ -20¡î 141758-74-9
¡¡
¡¡
¡¡
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM). Amino Acids Squence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2




¡¡ AST AST-292-10mg Exo-1 ¡ÚMethyl 2-(4-Fluorobenzamido)benzoate¡Û 10mg ¾È²ñ RT 461681-88-9
¡¡
¡¡
¡¡
Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 ¦ÌM. Rapidly releases Arf1 from Golgi




¡¡ AST AST-292-50mg Exo-1 ¡ÚMethyl 2-(4-Fluorobenzamido)benzoate¡Û 50mg ¾È²ñ RT 461681-88-9
¡¡
¡¡
¡¡
Cell permeable, reversible inhibitor of vesicular trafficking between endoplasmic reticulum and the Golgi apparatus. Inhibits exocytosis with an IC50 of approx 20 ¦ÌM. Rapidly releases Arf1 from Golgi




·àʪ AST AST-081-10mg FCCP ¡ÚCarbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone¡Û 10mg ¾È²ñ +4¡î 370-86-5
¡¡
¡¡
¡¡
A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.




·àʪ AST AST-081-50mg FCCP ¡ÚCarbonyl Cyanide 4-(Trifluoromethoxy)phenylhydrazone¡Û 50mg ¾È²ñ +4¡î 370-86-5
¡¡
¡¡
¡¡
A potent reversible inhibitor of mitochondrial oxidative phosphorylation. Depolarises mitochondrial membrane potential and induces apoptosis.




¡¡ AST AST-034-10mg Fenobam ¡Ú1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea¡Û 10mg ¾È²ñ +4¡î 57653-26-6
¡¡
¡¡
¡¡
Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie




¡¡ AST AST-034-50mg Fenobam ¡Ú1-(3-Chlorophenyl)-3-(4,5-dihydro-1-methyl-4-oxo-1H-imidazol-2-yl)urea¡Û 50mg ¾È²ñ +4¡î 57653-26-6
¡¡
¡¡
¡¡
Selective, potent mGlu5 receptor antagonist acting at an allosteric modulatory site (Kd = 54 nM and 31 nM at rat and human recombinant mGlu5 receptors respectively). Displays inverse agonist propertie




¡¡ AST AST-223-10mg FK506 10mg ¾È²ñ -20¡î 109581-93-3
¡¡
¡¡
¡¡
Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.




¡¡ AST AST-223-50mg FK506 50mg ¾È²ñ -20¡î 109581-93-3
¡¡
¡¡
¡¡
Immunosuppressant. Complexes with FKBP-12 to inhibit calcineurin.




¡¡ AST AST-242-10mg Flumazenil ¡Ú8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester¡Û¡ÚBenzodiazepine Antagonist¡Û 10mg ¾È²ñ +4¡î 78755-81-4
¡¡
¡¡
¡¡
Selective non-competitive benzodiazepine antagonist with low affinity for ¦Á4- and ¦Á6-subunits




¡¡ AST AST-242-50mg Flumazenil ¡Ú8-Fluoro-5,6-dihydro-5-methyl-6-oxo-4H-imidazo[1,5-a][1 ,4]benzodiazepine-3-carboxylic Acid, Ethyl Ester¡Û¡ÚBenzodiazepine Antagonist¡Û 50mg ¾È²ñ +4¡î 78755-81-4
¡¡
¡¡
¡¡
Selective non-competitive benzodiazepine antagonist with low affinity for ¦Á4- and ¦Á6-subunits




¡¡ AST AST-036-10mg (S)-5-Fluorowillardiine ¡ÚS)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 10mg ¾È²ñ +4¡î 140187-23-1
¡¡
¡¡
¡¡
Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.




¡¡ AST AST-036-50mg (S)-5-Fluorowillardiine ¡ÚS)-2-Amino-3-(5-fluoro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 50mg ¾È²ñ +4¡î 140187-23-1
¡¡
¡¡
¡¡
Potent, selective AMPA receptor agonist. Displays higher affinity than AMPA at hGluR1 and hGluR2, and displays greater selectivity for AMPA receptor subtypes over the kainate receptor hGluR5.




¡¡ AST AST-077-10mg Fluoxetine, HCl ¡ÚN-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl¡Û 10mg ¾È²ñ +4¡î 56296-78-7
¡¡
¡¡
¡¡
Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove




¡¡ AST AST-077-50mg Fluoxetine, HCl ¡ÚN-Methyl-3-[(4-trifluoromethyl)phenoxy]-3-phenylpropylamine, HCl¡Û 50mg ¾È²ñ +4¡î 56296-78-7
¡¡
¡¡
¡¡
Potent, selective 5HT reuptake inhibitor. Antidepressant in vivo. Binds to rat and human 5-HT transporters with Ki values of 2 and 0.9 - 20 nM respectively. Shows around 150- 900- fold selectivity ove




¡¡ AST AST-058-10mg Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û 10mg ¾È²ñ -20¡î 66575-29-9
¡¡
¡¡
¡¡
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti




¡¡ AST AST-058-50mg Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û 50mg ¾È²ñ -20¡î 66575-29-9
¡¡
¡¡
¡¡
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti




¡¡ AST AST-058-100mg Forskolin ¡Ú(3R,4aR,5S,6S,6aS,10S,10aR,10bS)-Dodecahydro-6,10,10b-trihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-1H-benzo[f]chromen-5-yl Acetate¡Û 100mg ¾È²ñ -20¡î 66575-29-9
¡¡
¡¡
¡¡
Cell-permeable activator of adenylate cyclase. Interacts directly with the catalytic subunit of the enzyme to increase intracellular cAMP levels. Positive inotropic, platelet anti-aggregatory and anti




¡¡ AST AST-219-10mg Gabapentin ¡Ú2-[1-(Aminomethyl)cyclohexyl]acetic Acid¡Û¡Ú¦Á2¦Ä Ligand¡Û 10mg ¾È²ñ +4¡î 60142-96-3
¡¡
¡¡
¡¡
Interacts with the ¦Á2¦Ä subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.




¡¡ AST AST-219-50mg Gabapentin ¡Ú2-[1-(Aminomethyl)cyclohexyl]acetic Acid¡Û¡Ú¦Á2¦Ä Ligand¡Û 50mg ¾È²ñ +4¡î 60142-96-3
¡¡
¡¡
¡¡
Interacts with the ¦Á2¦Ä subunit of L-type voltage gated Ca2+ channels. Disrupts calcium channel trafficking. Anticonvuslant and analgesic in vivo.




¡¡ AST AST-172-0.5mg Galanin (1-16) (porcine, rat) 0.5mg ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI




¡¡ AST AST-172-1mg Galanin (1-16) (porcine, rat) 1mg ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
N-terminal fragment of Galanin, involved in cardiovascular regulation. Amino Acids Sequence:GWTLNSAGYLLGPHAI




¡¡ AST AST-112-10mg Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û 10mg ¾È²ñ -20¡î 446-72-0
¡¡
¡¡
¡¡
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.




¡¡ AST AST-112-50mg Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û 50mg ¾È²ñ -20¡î 446-72-0
¡¡
¡¡
¡¡
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.




¡¡ AST AST-112-100mg Genistein ¡Ú5,7-Dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one¡Û¡ÚProtein Tyrosine Kinase Inhibitor¡Û¡ÚAnticancer Agent¡Û 100mg ¾È²ñ -20¡î 446-72-0
¡¡
¡¡
¡¡
Phytoestrogen found in soy beans. Anticancer agent. Inihibits tyrosine protein kinase and DNA topoisomerase as well as possessing antioxidant and cell cycle inhibitor activity.




¡¡ AST AST-230-1mg Ghrelin (human) 1mg ¾È²ñ -20¡î 258279-04-8
¡¡
¡¡
¡¡
Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se




¡¡ AST AST-231-1mg Ghrelin (rat) 1mg ¾È²ñ -20¡î 258279-04-8
¡¡
¡¡
¡¡
Endogenous agonist peptide for the ghrelin (GHS) receptor. Stimulates release of growth hormone from the pituitary gland and regulates feeding, appetite, growth and energy homeostasis. Amino Acids Se




¡¡ AST AST-267-100mg Glibenclamide ¡ÚN-p-[2-(5-Chloro-2-methoxybenzamido)ethyl]benzenesulfonyl-N'-cyclohexylurea¡Û 100mg ¾È²ñ RT 10238-21-8
¡¡
¡¡
¡¡
Selective blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.




¡¡ AST AST-049-1g L-Glutamate ¡Ú(S)-2-Aminopentanedioic Acid¡Û 1g ¾È²ñ +4¡î 56-86-0
¡¡
¡¡
¡¡
Excitatory neurotransmitter.




¡¡ AST AST-049-2.5g L-Glutamate ¡Ú(S)-2-Aminopentanedioic Acid¡Û 2.5g ¾È²ñ +4¡î 56-86-0
¡¡
¡¡
¡¡
Excitatory neurotransmitter.




¡¡ AST AST-050-100mg Glycine ¡Ú2-Aminoacetic Acid¡Û 100mg ¾È²ñ +4¡î 56-40-6
¡¡
¡¡
¡¡
Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.




¡¡ AST AST-050-1g Glycine ¡Ú2-Aminoacetic Acid¡Û 1g ¾È²ñ +4¡î 56-40-6
¡¡
¡¡
¡¡
Inhibitory neurotransmitter and allosteric regulator of NMDA receptors.




¡¡ AST AST-125-50mg Granisetron ¡Ú1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl¡Û¡Ú5HT3 Antagonist¡Û 50mg ¾È²ñ +4¡î 107007-99-8
¡¡
¡¡
¡¡
Highly selective 5HT3 antagonist. Anti-emetic.




¡¡ AST AST-125-250mg Granisetron ¡Ú1-Methyl-N-(9-methyl-endo-9-azabicyclo[3.3.1]non-3-yl-1H-indazole-3-carboxamide, HCl¡Û¡Ú5HT3 Antagonist¡Û 250mg ¾È²ñ +4¡î 107007-99-8
¡¡
¡¡
¡¡
Highly selective 5HT3 antagonist. Anti-emetic.




¡¡ AST AST-306-10mg HA-1077 ¡Ú1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl¡Û 10mg ¾È²ñ RT 103745-39-7
¡¡
¡¡
¡¡
ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 ¦ÌM, 4 ¦ÌM and 5 ¦ÌM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi




¡¡ AST AST-306-50mg HA-1077 ¡Ú1-(5-Isoquinolinylsulfonyl)homopiperazine, HCl¡Û 50mg ¾È²ñ RT 103745-39-7
¡¡
¡¡
¡¡
ROCK2 inhibitor with some actions on PRK2 and MSK1 ( IC50 values are 1.9 ¦ÌM, 4 ¦ÌM and 5 ¦ÌM respectively) Also shown to inhibit RSK1, RSK2, PKA , AMPK and PKd1. Calcium channel antagonist and vasodi




¡¡ AST AST-080-100mg Haloperidol ¡Ú4-[4-(4-Chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one¡Û 100mg ¾È²ñ +4¡î 52-86-3
¡¡
¡¡
¡¡
Dopamine antagonist with selectivity for D2-like receptors (Ki values are 1.2, 7, 2.3, 80 and 100 nM for D2, D3, D4, D1 and D5 receptors respectively). Also NMDA antagonist.




¡¡ AST AST-225-100mg Harmine ¡Ú7-Methoxy-1-methyl-9H-pyrido[3,4-b]indole¡Û 100mg ¾È²ñ RT 442-51-3
¡¡
¡¡
¡¡
Potent and selective inhibitor of DYRK1A (dual specificity tyrosine-phosphorylated and -regulated kinase). IC50 values are 0.08, 0.9, 0.8, 4.3 and 1.5 ¦ÌM for DYRK1A, DYRK2, DYRK3, PIM3 and CK1 respec




¡¡ AST AST-147-1mg Herkinorin ¡ÚNon-internalising ¦Ì Opioid Agonist¡Û 1mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective ¦Ì opioid receptor agonist derived from the plant product, salvinorin A (Asc-084). Does not promote the recruitment of beta-arrestin-2 or lead to receptor internalization.




¡¡ AST AST-041-1mg Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û 1mg ¾È²ñ -20¡î 2552-55-8
¡¡
¡¡
¡¡
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.




¡¡ AST AST-041-5mg Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û 5mg ¾È²ñ -20¡î 2552-55-8
¡¡
¡¡
¡¡
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.




¡¡ AST AST-041-25mg Ibotenic Acid ¡Ú2-Amino-2-(3-hydroxyisoxazol-5-yl)acetic Acid¡Û 25mg ¾È²ñ -20¡î 2552-55-8
¡¡
¡¡
¡¡
Neuroexcitatory amino acid originally isolated from Amanita species. Neurotoxin often used to model cognitive dysfunctions. NMDA and metabotropic receptor agonist.




¡¡ AST AST-131-10mg ICI 182,780 ¡Ú(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol¡Û¡ÚEstrogen receptor antagonist 10mg ¾È²ñ RT 129453-61-8
¡¡
¡¡
¡¡
Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.




¡¡ AST AST-131-50mg ICI 182,780 ¡Ú(7R,9S,13S,14S,17S)-7-(9-(4,4,5,5,5-Pentafluoropentylsulfinyl)nonyl)-7,8,9,11,12,13,14,15,16,17-decahydro-13-methyl-6H-cyclopenta[a]phenanthrene-3,17-diol¡Û¡ÚEstrogen receptor antagonist 50mg ¾È²ñ RT 129453-61-8
¡¡
¡¡
¡¡
Estrogen receptor antagonist with no partial agonist activity. Anticancer agent (IC50 = 0.29 nM for inhibition of breast cancer cell growth). Causes downregulation and loss of estrogen receptors.




¡¡ AST AST-111-10mg Ifenprodil ¡Ú4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate¡Û¡ÚNR2B-preferring NMDA Antagonist¡Û 10mg ¾È²ñ +4¡î 23210-58-4
¡¡
¡¡
¡¡
Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 ¦ÌM at NR1/NR2B and >30 ¦ÌM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors




¡¡ AST AST-111-50mg Ifenprodil ¡Ú4-(2-(4-Benzylpiperidin-1-yl)-1-hydroxypropyl)phenol Hemitartrate¡Û¡ÚNR2B-preferring NMDA Antagonist¡Û 50mg ¾È²ñ +4¡î 23210-58-4
¡¡
¡¡
¡¡
Non-competitive NMDA receptor antagonist acting at the polyamine site. Displays NR2B subunit selectivity. IC50 values are 0.15 ¦ÌM at NR1/NR2B and >30 ¦ÌM for NR1/NR2A, NR1/NR2C and NR1/NR2D receptors




¡¡ AST AST-222-10mg (S)-5-Iodowillardiine ¡Ú(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚGluR5 Kainate Agonist¡Û 10mg ¾È²ñ RT 140187-25-3
¡¡
¡¡
¡¡
Selective GluR5 Kainate receptor agonist (EC50 = 83 ¦ÌM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.




¡¡ AST AST-222-50mg (S)-5-Iodowillardiine ¡Ú(S)-2-Amino-3-(5-iodo-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚGluR5 Kainate Agonist¡Û 50mg ¾È²ñ RT 140187-25-3
¡¡
¡¡
¡¡
Selective GluR5 Kainate receptor agonist (EC50 = 83 ¦ÌM). Partial agonist activity at GluR6/KA2 receptors. Displays low affinity for AMPA and homomeric GluR6 and GluR7 receptors.




¡¡ AST AST-116-1mg Ionomycin Ca2+ Salt ¡ÚCalcium Ionophore¡Û 1mg ¾È²ñ +4¡î 56092-82-1
¡¡
¡¡
¡¡
Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.




¡¡ AST AST-116-5mg Ionomycin Ca2+ Salt ¡ÚCalcium Ionophore¡Û 5mg ¾È²ñ +4¡î 56092-82-1
¡¡
¡¡
¡¡
Ca2+ ionophore. Useful when calcium-dose response data are not required. Ion specificity Mn2+>Ca2+>Mg2+>>Sr2+>Ba2+.




¡¡ AST AST-142-10mg Isradipine ¡Ú4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 10mg ¾È²ñ +4¡î 75695-93-1
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker.




¡¡ AST AST-142-50mg Isradipine ¡Ú4-(4-Benzofurazanyl)-1,-4-dihydro-2,6-dimethyl-3,5-pyridinedicarboxylic Acid, Methyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 50mg ¾È²ñ +4¡î 75695-93-1
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker.




¡¡ AST AST-191-10mg JNJ 10191584 Mmaleate ¡Ú(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate¡Û¡ÚSelective H4 Antagonist¡Û 10mg ¾È²ñ RT 869497-75-6
¡¡
¡¡
¡¡
Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.




¡¡ AST AST-191-50mg JNJ 10191584 Mmaleate ¡Ú(5-Chloro-1H-benzo[d]imidazol-2-yl)(4-methylpiperazin-1-yl)methanone Maleate¡Û¡ÚSelective H4 Antagonist¡Û 50mg ¾È²ñ RT 869497-75-6
¡¡
¡¡
¡¡
Highly selective H4 receptor silent antagonist (Ki = 26 nM). Shows >540-fold selectivity over the H3 receptor (Ki = 14.1 ?M). Orally active in vivo.




¡¡ AST AST-100-10mg Kainic Acid ¡Ú(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid¡Û 10mg ¾È²ñ +4¡î 58002-62-3
¡¡
¡¡
¡¡
Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.




¡¡ AST AST-100-50mg Kainic Acid ¡Ú(2S,3S,4S)-3-(Carboxymethyl)-4-(prop-1-en-2-yl)pyrrolidine-2-carboxylic Acid¡Û 50mg ¾È²ñ +4¡î 58002-62-3
¡¡
¡¡
¡¡
Prototypic agonist at the kainate class of ionotropic glutamate receptors. Potent excitant and neurotoxin, used to model epilepsy and neurodegenerative states.




¡¡ AST AST-284-10mg KB-R7943 ¡Ú2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate¡Û 10mg ¾È²ñ RT 182004-65-5
¡¡
¡¡
¡¡
Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 ¦ÌM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 ¦ÌM, 0




¡¡ AST AST-284-50mg KB-R7943 ¡Ú2-{4-[(4-nitrophenyl)methoxy]phenyl}ethylester Carbamimidothioic Acid Methanesulfonate¡Û 50mg ¾È²ñ RT 182004-65-5
¡¡
¡¡
¡¡
Potent, selective inhibitor of the reverse mode of the Na+/Ca2+ exchanger (IC50 is approx ~ 0.32 ¦ÌM in guinea pig ventricular cells). Also potent blocker of TRPC channels (IC50 values are 0.46 ¦ÌM, 0




¡¡ AST AST-132-50mg Ketanserin Tartrate ¡Ú3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt¡Û¡ÚSelective 5HT2 Antagonist¡Û 50mg ¾È²ñ RT 83846-83-7
¡¡
¡¡
¡¡
5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1D¦Á over 5HT1¦Â, and affinity at ¦Á1 adrenoceptors. Antihypertensive in vivo.




¡¡ AST AST-132-250mg Ketanserin Tartrate ¡Ú3-(2-[4-(4-Fluorobenzoyl)-1-piperidinyl]ethyl)-2,4(1H,3H)-quinazolinedione Tartrate salt¡Û¡ÚSelective 5HT2 Antagonist¡Û 250mg ¾È²ñ RT 83846-83-7
¡¡
¡¡
¡¡
5HT2A antagonist. Also shows moderate affinity and selectivity for human 5HT1D¦Á over 5HT1¦Â, and affinity at ¦Á1 adrenoceptors. Antihypertensive in vivo.




¡¡ AST AST-181-1mg Kisspeptin-13 (4-13) ¡ÚAXOR12 Agonist¡Û (human) 1mg ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
Agonist of AXOR12 receptor (pEC50 = 9.30). Peptide derived from KiSS-1. Recently shown to be a potent vasoconstrictor in rat aorta (pD2 = 11.64) Amino Acids Sequence:YNWNSFGLRF-NH2




¡¡ AST AST-064-1g Kynurenic Acid ¡Ú4-Hydroxyquinoline-2-carboxylic Acid¡Û¡ÚEndogenous Ionotropic /Nicotinic Antagonist¡Û 1g ¾È²ñ RT 492-27-3
¡¡
¡¡
¡¡
Endogenous antagonist at ionotropic, Glycine ¦Â and ¦Á7 nicotinic receptors. Neuroprotective in vivo.




¡¡ AST AST-256-1g Kynurenic Acid ¡Ú4-Hydroxyquinoline-2-carboxylic Acid¡Û¡ÚEndogenous Ionotropic /Nicotinic Antagonist¡Û, Na salt 1g ¾È²ñ RT none
¡¡
¡¡
¡¡
Endogenous antagonist at ionotropic, glycine and ¦Á7 nicotinic receptors. Neuroprotective in vivo. Water soluble form.




¡¡ AST AST-188-1mg Locustatachykinin I ¡ÚInsect Tachykinin-related Peptide¡Û 1mg ¾È²ñ -20¡î 126985-97-5
¡¡
¡¡
¡¡
Insect tachykinin-related peptide isolated from Locusta migratoria. Exhibits sequence homology with vertebrate tachykinins.




¡¡ AST AST-184-5mg Luteinizing Hormone Releasing Hormone 5mg ¾È²ñ -20¡î 33515-09-2
¡¡
¡¡
¡¡
Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2




¡¡ AST AST-184-10mg Luteinizing Hormone Releasing Hormone 10mg ¾È²ñ -20¡î 33515-09-2
¡¡
¡¡
¡¡
Glycoprotein hormone involved in the regulation of reproductive processes. Amino Acids Sequence:Pyr-HWSYGLRPG-NH2




¡¡ AST AST-243-5mg LY 294002 ¡Ú2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one¡Û¡ÚPI-3 Kinase Inhibitor¡Û 5mg ¾È²ñ +4¡î 154447-36-6
¡¡
¡¡
¡¡
A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 ¦ÌM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >




¡¡ AST AST-243-25mg LY 294002 ¡Ú2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one¡Û¡ÚPI-3 Kinase Inhibitor¡Û 25mg ¾È²ñ +4¡î 154447-36-6
¡¡
¡¡
¡¡
A highly selective inhibitor of phosphatidylinositol 3-kinase (IC50 = 1.4 ¦ÌM). Selective over a range of other kinases including protein kinase C, protein kinase A, MAP kinase and PI-4 kinase (IC50 >




¡¡ AST AST-199-1mg LY 341495 ¡Ú(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid¡Û 1mg ¾È²ñ RT 201943-63-7
¡¡
¡¡
¡¡
Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a




¡¡ AST AST-199-5mg LY 341495 ¡Ú(2S)-2-Amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl)propanoic Acid¡Û 5mg ¾È²ñ RT 201943-63-7
¡¡
¡¡
¡¡
Very selective nanomolar potent antagonist for group II mGlu receptors. Also a relatively potent antagonist for group III mGlu receptors at high nanomolar to low micromolar concentrations. Kd values a




¡¡ AST AST-173-10mg LY 354740 ¡Ú(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto




¡¡ AST AST-173-50mg LY 354740 ¡Ú(1S,2S,5R,6S)-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylic Acid¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Highly potent and selective agonist at mGlu2 and mGlu3 receptors (EC50 values are 5.1 nM and 24.3 nM respectively). Displays no agonist or antagonist activity at mGlu1a, mGlu5a, mGlu4 or mGlu7 recepto




¡¡ AST AST-196-10mg LY 379268 ¡Ú(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid¡Û 10mg ¾È²ñ +4¡î 191471-52-0
¡¡
¡¡
¡¡
Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto




¡¡ AST AST-196-50mg LY 379268 ¡Ú(1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic Acid¡Û 50mg ¾È²ñ +4¡î 191471-52-0
¡¡
¡¡
¡¡
Highly potent and systemically active mGlu2 and mGlu3 agonist. EC50 values are 2.69 and 4.48 nM for hmGlu2 and hmGlu3 respectively and displays > 80-fold selectivity over group I and group III recepto




¡¡ AST AST-201-10mg LY 456236 ¡Ú(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.




¡¡ AST AST-201-50mg LY 456236 ¡Ú(4-Methoxyphenyl)-(6-methoxy-quinazolin-4-yl)amine, HCl¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective non-competitive antagonist at the mGlu1 receptor. Inhibits agonist induced phosphoinositide hydrolysis in vitro (IC50 value of 140 nM) and in vivo following systemic administration.




¡¡ AST AST-252-10mg (RS)-MCGP, Na salt ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine, Na salt¡Û 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.




¡¡ AST AST-252-50mg (RS)-MCGP, Na salt ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine, Na salt¡Û 50mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Group I / group II metabotropic glutamate receptor antagonist. Water soluble form.




¡¡ AST AST-033-10mg (R,S)-MCPG ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine¡Û 10mg ¾È²ñ +4¡î 146669-29-6
¡¡
¡¡
¡¡
Group I / group II metabotropic glutamate receptor antagonist.




¡¡ AST AST-033-50mg (R,S)-MCPG ¡Ú(R,S)-¦Á-Methyl-4-carboxyphenylglycine¡Û 50mg ¾È²ñ +4¡î 146669-29-6
¡¡
¡¡
¡¡
Group I / group II metabotropic glutamate receptor antagonist.




¡¡ AST AST-059-10mg (S)-MCPG ¡Ú(S)-¦Á-Methyl-4-carboxyphenylglycine¡Û 10mg ¾È²ñ +4¡î 150145-89-4
¡¡
¡¡
¡¡
Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.




¡¡ AST AST-059-50mg (S)-MCPG ¡Ú(S)-¦Á-Methyl-4-carboxyphenylglycine¡Û 50mg ¾È²ñ +4¡î 150145-89-4
¡¡
¡¡
¡¡
Active isomer of (R,S)-MCPG (#Asc-033). Group I / II mGlu receptor antagonist, with some reported activity at mGlu8.




¡¡ AST AST-249-50mg Memantine ¡Ú3,5-Dimethyl-1-adamantanamine¡Û, HCl 50mg ¾È²ñ RT 41100-52-1
¡¡
¡¡
¡¡
Antagonist at the NMDA receptor. Acts as a fast, voltage-dependent, open channel NMDA receptor blocker. Used in the clinic to treat Alzheimer's Disease. Cognitive enhancer and anxiolytic in vivo.




¡¡ AST AST-053 (R)-(-)-¦Á-Methylhistamine, 2HBr ¡Ú(R)-1-(1H-Imidazol-4-yl)propan-2-amine¡Û - - - Discontinued ¾È²ñ +4¡î 75614-87-8
¡¡
¡¡
¡¡
Potent, selective H3 histamine receptor agonist which crosses the blood-brain barrier; inhibits histamine synthesis and release.




¡¡ AST AST-119-10mg N-Methyllidocaine Iodide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide¡Û¡ÚAnti-arrthymic¡Û 10mg ¾È²ñ +4¡î 29199-61-9
¡¡
¡¡
¡¡
Anti-arrhythmic. Enhances phosphatidyl biosynthesis.




¡¡ AST AST-119-50mg N-Methyllidocaine Iodide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)diethylmethylammonium Iodide¡Û¡ÚAnti-arrthymic¡Û 50mg ¾È²ñ +4¡î 29199-61-9
¡¡
¡¡
¡¡
Anti-arrhythmic. Enhances phosphatidyl biosynthesis.




¡¡ AST AST-072-5mg Methyllycaconitine Citrate ¡Ú[1¦Á,4(S),6¦Â,14¦Á,16¦Â]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate¡Û¡Ú¦Á7-Nicotinic Receptor 5mg ¾È²ñ -20¡î 21019-30-7
¡¡
¡¡
¡¡
Potent, selective antagonist at ¦Á7-containing nicotinic receptors.




¡¡ AST AST-072-25mg Methyllycaconitine Citrate ¡Ú[1¦Á,4(S),6¦Â,14¦Á,16¦Â]-20-Ethyl-1,6,14,16-tetramethoxy-4-[[[2-(3-methyl-2,5-dioxo-1-pyrrolidinyl)benzoyl]oxy]methyl]aconitane-7,8-diol Citrate¡Û¡Ú¦Á7-Nicotinic Receptor 25mg ¾È²ñ -20¡î 21019-30-7
¡¡
¡¡
¡¡
Potent, selective antagonist at ¦Á7-containing nicotinic receptors.




¡¡ AST AST-068-10mg Mirtazepine ¡Ú1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine¡Û¡ÚAntidepressant¡Û¡Ú¦Á2, 5HT2, 5HT3 Antagonist¡Û 10mg ¾È²ñ +4¡î 61337-67-5
¡¡
¡¡
¡¡
Antagonist at ¦Á2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.




¡¡ AST AST-068-50mg Mirtazepine ¡Ú1,2,3,4,10,14b-Hexahydro-2-methylpyrazino(2,1-a)pyrido(2,3-c)benzazepine¡Û¡ÚAntidepressant¡Û¡Ú¦Á2, 5HT2, 5HT3 Antagonist¡Û 50mg ¾È²ñ +4¡î 61337-67-5
¡¡
¡¡
¡¡
Antagonist at ¦Á2, 5HT2 and 5HT3 receptors. Antidepressant in vivo.




¡¡ AST AST-028-10mg (-)-MK 801 Maleate ¡Ú5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û 10mg ¾È²ñ +4¡î 77086-19-2
¡¡
¡¡
¡¡
Less active enantiomer than (+)-MK 801.




¡¡ AST AST-028-50mg (-)-MK 801 Maleate ¡Ú5R,10S)-(-)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û 50mg ¾È²ñ +4¡î 77086-19-2
¡¡
¡¡
¡¡
Less active enantiomer than (+)-MK 801.




¡¡ AST AST-027-10mg (+)-MK 801 Maleate ¡ÚDizocilpine¡Û¡Ú(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û 10mg ¾È²ñ +4¡î 77086-22-7
¡¡
¡¡
¡¡
Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.




¡¡ AST AST-027-50mg (+)-MK 801 Maleate ¡ÚDizocilpine¡Û¡Ú(5S,10R)-(+)-5-Methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine Maleate¡Û 50mg ¾È²ñ +4¡î 77086-22-7
¡¡
¡¡
¡¡
Potent, selective non-competitive NMDA receptor antagonist. Open channel blocker of the NMDA receptor operated ion channel.




¡¡ AST AST-245-10mg MMPIP ¡Ú6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one¡Û¡ÚmGlu7 Allosteric Antagonist¡Û 10mg ¾È²ñ RT 479077-02-6
¡¡
¡¡
¡¡
Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a




¡¡ AST AST-245-50mg MMPIP ¡Ú6-(4-Methoxyphenyl)-5-methyl-3-(4-pyridinyl)isoxazolo[4,5-c]pyridin-4(5H)-one¡Û¡ÚmGlu7 Allosteric Antagonist¡Û 50mg ¾È²ñ RT 479077-02-6
¡¡
¡¡
¡¡
Potent, selective allosteric antagonist at mGlu7 receptors. Inhibits agonist-induced intracellular calcium mobilisation and cAMP accumulation (IC50 values are 26 and 610 nM). Also displays intrinsic a




¡¡ AST AST-137-10mg NG-Monomethyl-L-arginine, Monoacetate salt ¡ÚNG-Methyl-L-arginine Acetate salt¡Û¡ÚNOS Inhibitor¡Û 10mg ¾È²ñ RT 53308-83-1
¡¡
¡¡
¡¡
Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.




¡¡ AST AST-137-50mg NG-Monomethyl-L-arginine, Monoacetate salt ¡ÚNG-Methyl-L-arginine Acetate salt¡Û¡ÚNOS Inhibitor¡Û 50mg ¾È²ñ RT 53308-83-1
¡¡
¡¡
¡¡
Cell permeable competitive NOS inhibitor. Ki values are = 700 nM, 3.9 ?M, and 650 nM for eNOS, iNOS and nNOS respectively.




¡¡ AST AST-008-10mg MPEP, HCl ¡Ú2-Methyl-6-(phenylethynyl)pyridine, HCl¡Û 10mg ¾È²ñ +4¡î 96206-92-7
¡¡
¡¡
¡¡
Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.




¡¡ AST AST-008-50mg MPEP, HCl ¡Ú2-Methyl-6-(phenylethynyl)pyridine, HCl¡Û 50mg ¾È²ñ +4¡î 96206-92-7
¡¡
¡¡
¡¡
Subtype selective and potent non-competitive mGlu5 antagonist (IC50 = 36 nM). Central effects following systemic administration in vivo.




¡¡ AST AST-205-5mg ¦Á-MSH (free acid) ¡ÚEndogenous Melanocortin Receptor Agonist¡Û 5mg ¾È²ñ -20¡î 10466-28-1
¡¡
¡¡
¡¡
Free acid form of the endogenous melanocortin receptor agonist involved in feeding, homeostasis, body weight and inflammation. Amino Acids Sequence¡§Ac-SYSMEHFRWGKPV




¡¡ AST AST-189-1mg ¦Á-MSH ¡ÚEndogenous Melanocortin Receptor Agonist¡Û 1mg ¾È²ñ -20¡î 581-05-5
¡¡
¡¡
¡¡
Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2




¡¡ AST AST-189-5mg ¦Á-MSH ¡ÚEndogenous Melanocortin Receptor Agonist¡Û 5mg ¾È²ñ -20¡î 581-05-5
¡¡
¡¡
¡¡
Endogenous melanocortin receptor agonist involved in feeding homeostasis, body weight and inflammation. Amino Acids Sequence: Ac-SYSMEHFRWGKPV-NH2




¡¡ AST AST-035-10mg MTEP, HCl ¡Ú3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side ffects seen with MPEP and benzodiazepi




¡¡ AST AST-035-50mg MTEP, HCl ¡Ú3-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]pyridine, HCl¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Brain penetrant, potent, selective and non-competitive mGlu5 receptor antagonist (IC50 = 5 nM in Ca2+-flux assay; Ki = 16 nM). In vivo anxiolytic, devoid of side effects seen with MPEP and benzodiaze




¡¡ AST AST-094-5mg Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û 5mg ¾È²ñ +4¡î 2763-96-4
¡¡
¡¡
¡¡
Potent, selective GABAA agonist.




¡¡ AST AST-094-10mg Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û 10mg ¾È²ñ +4¡î 2763-96-4
¡¡
¡¡
¡¡
Potent, selective GABAA agonist.




¡¡ AST AST-094-50mg Muscimol ¡Ú5-(Aminomethyl)isoxazol-3-ol¡Û¡ÚPotent, selective GABAA Agonist¡Û 50mg ¾È²ñ +4¡î 2763-96-4
¡¡
¡¡
¡¡
Potent, selective GABAA agonist.




¡¡ AST AST-099-5mg NADA ¡Ú(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous CB1 / TRPV1 Agonist¡Û 5mg ¾È²ñ -20¡î 199875-69-9
¡¡
¡¡
¡¡
Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 ¦ÌM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.




¡¡ AST AST-099-25mg NADA ¡Ú(5Z,8Z,11Z,14Z)-N-(3,5-dihydroxyphenethyl)icosa-5,8,11,14-tetraenamide¡Û¡ÚEndogenous CB1 / TRPV1 Agonist¡Û 25mg ¾È²ñ -20¡î 199875-69-9
¡¡
¡¡
¡¡
Potent endogenous cannabinoid and vanilloid receptor agonist. Ki values are 0.25 and 12 ¦ÌM for CB1 and CB2 respectively. Potent agonist at TRPV1 (VR1) receptors (EC50 ~ 50 nM). Active in vivo.




¡¡ AST AST-074-100mg Naloxone, HCl ¡Ú(5¦Á)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl¡Û 100mg ¾È²ñ +4¡î 357-08-4
¡¡
¡¡
¡¡
Competitive opioid antagonist.




¡¡ AST AST-074-250mg Naloxone, HCl ¡Ú(5¦Á)-4,5-Epoxy-3,14-dihydro-17-(2-propenyl)morpinan-6-one, HCl¡Û 250mg ¾È²ñ +4¡î 357-08-4
¡¡
¡¡
¡¡
Competitive opioid antagonist.




¡¡ AST AST-075-100mg Naltrexone, HCl ¡Ú(5¦Á)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl¡Û 100mg ¾È²ñ +4¡î 16676-29-2
¡¡
¡¡
¡¡
Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for ¦Ì, d, and k-receptors respectively.




¡¡ AST AST-075-250mg Naltrexone, HCl ¡Ú(5¦Á)-(17-Cyclopropylmethyl)-4,5-epoxy-3,14-dihydromorphinan-6-one, HCl¡Û 250mg ¾È²ñ +4¡î 16676-29-2
¡¡
¡¡
¡¡
Competitive opioid receptor antagonist. Ki values are 1.55 nM, 7.84 nM and 0.71 nM for ¦Ì, d, and k-receptors respectively.




¡¡ AST AST-045-10mg NBQX ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide¡Û 10mg ¾È²ñ +4¡î 118876-58-7
¡¡
¡¡
¡¡
Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.




¡¡ AST AST-045-50mg NBQX ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide¡Û 50mg ¾È²ñ +4¡î 118876-58-7
¡¡
¡¡
¡¡
Potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.




¡¡ AST AST-046-10mg NBQX, 2Na salt ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.




¡¡ AST AST-046-50mg NBQX, 2Na salt ¡Ú2,3-Dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide, 2Na salt¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Water soluble, potent, selective and competitive AMPA/kainate receptor antagonist. Neuroprotective and anticonvulsant in vivo.




¡¡ AST AST-185-5mg Neurokinin A 5mg ¾È²ñ -20¡î 86933-74-6
¡¡
¡¡
¡¡
Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2




¡¡ AST AST-185-25mg Neurokinin A 25mg ¾È²ñ -20¡î 86933-74-6
¡¡
¡¡
¡¡
Endogenous tachykinin peptide Amino Acids Sequence:HKTDSFVGLM-NH2




¡¡ AST AST-174-1mg Neuropeptide S ¡ÚNPS Receptor Agonist¡Û (mouse) 1mg ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ




¡¡ AST AST-246-1mg Neuropeptide S (mouse) 1mg ¾È²ñ -20¡î none
¡¡
¡¡
¡¡
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGAKKTSFRRAKQ




¡¡ AST AST-208-0.5mg Neuropeptide S (rat) 0.5mg ¾È²ñ -20¡î 412938-75-1
¡¡
¡¡
¡¡
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ




¡¡ AST AST-208-1mg Neuropeptide S (rat) 1mg ¾È²ñ -20¡î 412938-75-1
¡¡
¡¡
¡¡
Endogenous ligand for the NPS receptor involved in many biological functions including sleeping/wakening, locomotion, anxiety, and food intake. Amino Acids Sequence:SFRNGVGSGVKKTSFRRAKQ




¡¡ AST AST-171-1mg Neuropeptide Y (13-36) ¡ÚNPY Y2 Agonist¡Û (porcine) 1mg ¾È²ñ -20¡î 113662-54-7
¡¡
¡¡
¡¡
Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2




¡¡ AST AST-171-5mg Neuropeptide Y (13-36) ¡ÚNPY Y2 Agonist¡Û (porcine) 5mg ¾È²ñ -20¡î 113662-54-7
¡¡
¡¡
¡¡
Neuropeptide Y2 agonist (Ki values are 5.7, 0.2 and 320 nM at guinea pig Y1, Y2 and Y5 respectively). Amino Acids Sequence:PAEDLARYYSALRHYINLITRQRY-NH2




¡¡ AST AST-145-10g Nicotinic Acid ¡ÚPyridine-3-carboxylic Acid¡Û¡ÚAntidyslipidemic Agent¡Û 10g ¾È²ñ RT 59-67-6
¡¡
¡¡
¡¡
Antidyslipidemic. Increases high-density- and lowers low-density lipoproteins. Putative ligand for the HM74A receptor.




¡¡ AST AST-135-250mg Nifedipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 250mg ¾È²ñ +4¡î 21829-25-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.




¡¡ AST AST-135-1g Nifedipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(2-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Dimethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 1g ¾È²ñ +4¡î 21829-25-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Potent, long-acting vasodilator. Also shown to inhibit vascular inflammation.




¡¡ AST AST-138-100mg Nimodipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 100mg ¾È²ñ ?׸÷ +4¡î 66085-59-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.




¡¡ AST AST-138-500mg Nimodipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, 2-Methoxyethyl 1-Methylethyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 500mg ¾È²ñ ?׸÷ +4¡î 66085-59-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Potent, cerebrovasodilator. Cognitive enhancer. More lipophilic than nifedipine.




¡¡ AST AST-312-100mg Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û 100mg ¾È²ñ RT 60252-41-7
¡¡
¡¡
¡¡
GABA reuptake inhibitor.




¡¡ AST AST-312-1g Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û 1g ¾È²ñ RT 60252-41-7
¡¡
¡¡
¡¡
GABA reuptake inhibitor.




¡¡ AST AST-312-5g Nipecotic Acid ¡Ú(+/-)-3-Piperidine carboxylic Acid¡Û 5g ¾È²ñ RT 60252-41-7
¡¡
¡¡
¡¡
GABA reuptake inhibitor.




¡¡ AST AST-139-100mg Nitrendipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 100mg ¾È²ñ RT 39562-70-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Antihypertensive in vivo.




¡¡ AST AST-139-500mg Nitrendipine ¡Ú1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylic Acid, Ethyl Methyl Ester¡Û¡ÚL-type Ca2+ Channel Blocker¡Û 500mg ¾È²ñ RT 39562-70-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Antihypertensive in vivo.




¡¡ AST AST-136-100mg N¦Ø-Nitro-L-arginine Methyl Ester, HCl 100mg ¾È²ñ +4¡î 51298-62-5
¡¡
¡¡
¡¡
Cell permeable NOS inhibitor. More soluble analogue of arginine. pIC50 values are 4.3, 5.7 and 5.6 at human iNOS, nNOA and eNOS respectively.




¡¡ AST AST-233-50mg 7-Nitroindazole ¡ÚNOS Inhibitor¡Û 50mg ¾È²ñ -20¡î 2942-42-9
¡¡
¡¡
¡¡
Competitive, reversible and non-selective NOS inhibitor. Neuroprotective, anticonvulsant and anxiolytic in vivo.




¡¡ AST AST-285--10mg S-Nitrosoglutathione 10mg ¾È²ñ -20¡î 57564-91-7
¡¡
¡¡
¡¡
carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.




¡¡ AST AST-285-50mg S-Nitrosoglutathione 50mg ¾È²ñ -20¡î 57564-91-7
¡¡
¡¡
¡¡
carrier of nitric oxide. Breaks down at physiological pH to produce nitric oxide. Relaxes smooth muscle and inhibits platelet aggregation.




¡¡ AST AST-063-10mg (S)-5-Nitrowillardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors




¡¡ AST AST-063-50mg (S)-5-Nitrowillardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-5-nitro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Broad spectrum agonist for AMPA and kainate receptors with no activity at NMDA or metabotropic receptors




¡¡ AST AST-190-10mg NKH 477 ¡ÚN,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester ¦Â-alanine, HCl¡Û 10mg ¾È²ñ +4¡î 138605-00-2
¡¡
¡¡
¡¡
Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator




¡¡ AST AST-190-50mg NKH 477 ¡ÚN,N-Dimethyl-(3R,4aR,5S,6aS,10S,10aR,10bS)-5-(acetyloxy)-3-ethenyldodecahydro-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-1H-naphtho[2,1-b]pyran-6-yl ester ¦Â-alanine, HCl¡Û 50mg ¾È²ñ +4¡î 138605-00-2
¡¡
¡¡
¡¡
Water-soluble analogue of forskolin (Asc-058), an adenylyl cyclase activator




¡¡ AST AST-052-50mg NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û 50mg ¾È²ñ +4¡î 6384-92-5
¡¡
¡¡
¡¡
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.




¡¡ AST AST-052-100mg NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û 100mg ¾È²ñ +4¡î 6384-92-5
¡¡
¡¡
¡¡
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.




¡¡ AST AST-052-500mg NMDA ¡Ú(R)-2-(Methylamino)succinic Acid¡Û 500mg ¾È²ñ +4¡î 6384-92-5
¡¡
¡¡
¡¡
Excitotoxic amino acid. Prototypic agonist at the ionotropic NMDA glutamate receptor which is involved in long-term potentiation, ischemia, and epilepsy.




¡¡ AST AST-070-1mg Nociceptin ¡ÚORL1 Agonist¡Û 1mg ¾È²ñ +4¡î 170713-75-4
¡¡
¡¡
¡¡
Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH




¡¡ AST AST-070-5mg Nociceptin ¡ÚORL1 Agonist¡Û 5mg ¾È²ñ +4¡î 170713-75-4
¡¡
¡¡
¡¡
Endogenous ligand for the opioid-like receptor, ORL1 Amino Acids Sequence:H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-Leu-Ala-Asn-Gln-OH




¡¡ AST AST-078-10mg Nor-Binaltorphimine, 2HCl 10mg ¾È²ñ +4¡î 105618-26-6
¡¡
¡¡
¡¡
Potent and selective ¦Ê-Opioid receptor antagonist




¡¡ AST AST-078-50mg Nor-Binaltorphimine, 2HCl 50mg ¾È²ñ +4¡î 105618-26-6
¡¡
¡¡
¡¡
Potent and selective ¦Ê-Opioid receptor antagonist




¡¡ AST AST-071-1mg Obestatin 1mg ¾È²ñ +4¡î 869705-22-6
¡¡
¡¡
¡¡
Obestatin, a peptide encoded by the ghrelin gene that suppresses food intake. Binds to the orphan G-protein-coupled receptor GPR39. Amino Acids Sequence:H-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-IIe-Lys-Leu-




¡¡ AST AST-022-10mg ODQ ¡Ú1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one¡Û 10mg ¾È²ñ +4¡î 41443-28-1
¡¡
¡¡
¡¡
Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.




¡¡ AST AST-022-50mg ODQ ¡Ú1H-[1,2,4]Oxadiazolo[4,3-a]quinoxalin-1-one¡Û 50mg ¾È²ñ +4¡î 41443-28-1
¡¡
¡¡
¡¡
Selective, potent inhibitor of nitric oxide-sensitive guanylyl cyclase.




¡¡ AST AST-134-10mg Ondansetron ¡Ú2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one¡Û¡ÚSelective 5HT3 Antagonist¡Û 10mg ¾È²ñ -20¡î 99614-02-5
¡¡
¡¡
¡¡
Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.




¡¡ AST AST-134-50mg Ondansetron ¡Ú2,3-Dihydro-9-methyl-3-((2-methyl-1H-imidazol-1-yl)methyl)-1H-carbazol-4(9H)-one¡Û¡ÚSelective 5HT3 Antagonist¡Û 50mg ¾È²ñ -20¡î 99614-02-5
¡¡
¡¡
¡¡
Highly potent and selective 5HT3 antagonist. Potent anti-emetic in vivo.




¡¡ AST AST-212-0.1mg Orexin A (bovine, human, mouse, rat) 0.1mg ¾È²ñ -20¡î 205640-90-0
¡¡
¡¡
¡¡
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14




¡¡ AST AST-212-0.5mg Orexin A (bovine, human, mouse, rat) 0.5mg ¾È²ñ -20¡î 205640-90-0
¡¡
¡¡
¡¡
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14




¡¡ AST AST-212-1mg Orexin A (bovine, human, mouse, rat) 1mg ¾È²ñ -20¡î 205640-90-0
¡¡
¡¡
¡¡
Hypothalamic neuropeptide involved in the regulation of feeding, sleep and wakefullness. Amino Acids Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 disulfide bridges: 6-12 and 7-14




¡¡ AST AST-186-5mg Oxytocin ¡ÚReproductive Hormone¡Û 5mg ¾È²ñ -20¡î 50-56-6
¡¡
¡¡
¡¡
Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-




¡¡ AST AST-186-25mg Oxytocin ¡ÚReproductive Hormone¡Û 25mg ¾È²ñ -20¡î 50-56-6
¡¡
¡¡
¡¡
Involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino Acids Sequence:CYIQNCPLG-NH2 disulfide bridge 1-




¡¡ AST AST-204-5mg Oxytocin ¡ÚReproductive Hormone¡Û, free-acid 5mg ¾È²ñ -20¡î 24346-32-5
¡¡
¡¡
¡¡
Free acid form of oxytocin, which is a hormone involved in many aspects of mammalian reproduction as well as other physiological processes such as bond pairing and cardiovascular homeostasis. Amino A




¡¡ AST AST-143-10mg Paclitaxel ¡ÚAnticancer Agent¡Û 10mg ¾È²ñ -20¡î 33069-62-4
¡¡
¡¡
¡¡
Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.




¡¡ AST AST-143-50mg Paclitaxel ¡ÚAnticancer Agent¡Û 50mg ¾È²ñ -20¡î 33069-62-4
¡¡
¡¡
¡¡
Anticancer agent. Inhibits depolymerization of microtubules, causing mitotic arrest in cancer cells, and apoptosis.




¡¡ AST AST-069-10mg Paroxetine, HCl ¡Ú(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl¡Û¡Ú5HT Uptake Inhibitor¡Û 10mg ¾È²ñ +4¡î 110429-35-1
¡¡
¡¡
¡¡
Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.




¡¡ AST AST-069-50mg Paroxetine, HCl ¡Ú(3S,4R)-3-((Benzo[d][1,3]dioxol-5-yloxy)methyl)-4-(4-fluorophenyl)piperidine, HCl¡Û¡Ú5HT Uptake Inhibitor¡Û 50mg ¾È²ñ +4¡î 110429-35-1
¡¡
¡¡
¡¡
Potent, selective 5HT (serotonin) uptake inhibitor. Inhibits human and rat 5HT transporters with Ki values of 0.065 nM and 0.05 nM. Antidepressant and anxiolytic in vivo.




¡¡ AST AST-234-1mg PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û 1mg ¾È²ñ RT 167869-21-8
¡¡
¡¡
¡¡
Inhibitor of MKK1 (MEK1).




¡¡ AST AST-234-10mg PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û 10mg ¾È²ñ RT 167869-21-8
¡¡
¡¡
¡¡
Inhibitor of MKK1 (MEK1).




¡¡ AST AST-234-50mg PD 98059 ¡Ú2-(2-Amino-3-methoxyphenyl)-4H-1-benzopyran-4-one¡Û¡ÚMEK1 Inhibitor¡Û 50mg ¾È²ñ RT 167869-21-8
¡¡
¡¡
¡¡
Inhibitor of MKK1 (MEK1).




¡¡ AST AST-043-10mg PHCCC ¡Ú(E)-1,1¦Á,7,7¦Á-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1¦Á-carboxamide¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.




¡¡ AST AST-043-50mg PHCCC ¡Ú(E)-1,1¦Á,7,7¦Á-Tetrahydro-7-(hydroxyimino)-N-phenylcyclopropa[b]chromene-1¦Á-carboxamide¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Selective allosteric potentiator of mGlu4. Anti-Parkinson and anxiolytic effects in vivo. Also antagonist at Group I metabotropic receptors.




·àʪ AST AST-335-1mg Philanthotoxin-7,4 ¡Ú6,7-Dihydro-4-hydroxy-3-(2'-hydroxy[1,1'-biphenyl]-4-yl)-6-oxo-thieno[2,3-b]pyridine-5-carbonitrile¡Û 1mg ¾È²ñ RT 401601-12-5
¡¡
¡¡
¡¡
A subtype-selective, use-dependent inhibitor of native AMPA receptors. Inhibits GluA1/A2 (formerly GluR1/2), with little activity at GluA2/A3 (formerly GluR2/3)




¡¡ AST AST-297-1mg Phorbol 12-Myristate 13-Acetate 1mg ¾È²ñ -20¡î 16561-29-8
¡¡
¡¡
¡¡
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non




¡¡ AST AST-297-5mg Phorbol 12-Myristate 13-Acetate 5mg ¾È²ñ -20¡î 16561-29-8
¡¡
¡¡
¡¡
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non




¡¡ AST AST-297-25mg Phorbol 12-Myristate 13-Acetate 25mg ¾È²ñ -20¡î 16561-29-8
¡¡
¡¡
¡¡
Potent nanomolar activator of protein kinase C in vivo and in vitro. Binds to C1 domain of protein kinase C, induces membrane translocation and enzyme activation. Also reported to have actions on non




¡¡ AST AST-079-0.5mg Phospho-Glycogen Synthase Peptide-2 0.5mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE




¡¡ AST AST-079-1mg Phospho-Glycogen Synthase Peptide-2 1mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Glycogen synthase kinase substrate. Amino Acids Sequence:YRRAAVPPSPSLSRHSSPHQS(PO4H2)-EDEEE




¡¡ AST AST-315-1g Picrotoxin 1g ¾È²ñ -20¡î 124-87-8
¡¡
¡¡
¡¡
Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin




¡¡ AST AST-315-5g Picrotoxin 5g ¾È²ñ -20¡î 124-87-8
¡¡
¡¡
¡¡
Plant alkaloid. Non-competitive GABAA antagonist. Also inhibits homomeric glycine receptor. Convulsant in vivo. Note: 1:1 mixture of picrotoxinin and picrotin




¡¡ AST AST-038-50mg 2,3 cis-Piperidine dicarboxylic Acid ¡Úcis-PDA¡Û¡Úcis-Piperidine-2,3-dicarboxylic Acid¡Û 50mg ¾È²ñ +4¡î 46026-75-9
¡¡
¡¡
¡¡
General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.




¡¡ AST AST-038-250mg 2,3 cis-Piperidine dicarboxylic Acid ¡Úcis-PDA¡Û¡Úcis-Piperidine-2,3-dicarboxylic Acid¡Û 250mg ¾È²ñ +4¡î 46026-75-9
¡¡
¡¡
¡¡
General ionotropic receptor antagonist. Blocks NMDA, AMPA and kainate mediated responses. Also acts as a partial NMDA receptor agonist in the in vitro rat cerebellar cGMP model.




¡¡ AST AST-153-100mg Pirenzepine, 2HCl ¡Ú5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl¡Û¡ÚM1 Antagonist¡Û 100mg ¾È²ñ RT 28797-61-7
¡¡
¡¡
¡¡
Selective M1 receptor antagonist.




¡¡ AST AST-153-500mg Pirenzepine, 2HCl ¡Ú5,11-Dihydro-11-[(4-methyl-1-piperazinyl)acetyl]-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one, 2HCl¡Û¡ÚM1 Antagonist¡Û 500mg ¾È²ñ RT 28797-61-7
¡¡
¡¡
¡¡
Selective M1 receptor antagonist.




¡¡ AST AST-308-1mg PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û 1mg ¾È²ñ +4¡î 172889-27-9
¡¡
¡¡
¡¡
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel




¡¡ AST AST-308-5mg PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û 5mg ¾È²ñ +4¡î 172889-27-9
¡¡
¡¡
¡¡
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel




¡¡ AST AST-308-10mg PP2 ¡Ú1-tert-Butyl-3-(4-chlorophenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine¡Û 10mg ¾È²ñ +4¡î 172889-27-9
¡¡
¡¡
¡¡
Inhibitor of the Src family of kinases. Inhibits Src and Lck kinase with IC50 values of 36 nM and 31 nM respectively. Also shown to inhibit RIP2, and CK1¦Ä (IC50 values are 19 nM and 41 nM respectivel




¡¡ AST AST-009-10mg PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û 10mg ¾È²ñ -20¡î 149017-66-3
¡¡
¡¡
¡¡
P2 purinergic receptor antagonist.




¡¡ AST AST-009-50mg PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û 50mg ¾È²ñ -20¡î 149017-66-3
¡¡
¡¡
¡¡
P2 purinergic receptor antagonist.




¡¡ AST AST-009-250mg PPADS ¡Ú4-[{4-Formyl-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-2-pyridinyl}azo]-1,3-benzenedisulfonic Acid, 4Na salt¡Û 250mg ¾È²ñ -20¡î 149017-66-3
¡¡
¡¡
¡¡
P2 purinergic receptor antagonist.




¡¡ AST AST-047-10mg cis-PPDA ¡Ú(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 ¦ÌM, 0.125 ¦ÌM, 0.55 ¦ÌM and 0.31 ¦ÌM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.




¡¡ AST AST-047-50mg cis-PPDA ¡Ú(2R*,3S*)-1-(Phenanthrenyl-2-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent selective NR2C / NR2D-preferring NMDA receptor antagonist. Ki values are 0.096 ¦ÌM, 0.125 ¦ÌM, 0.55 ¦ÌM and 0.31 ¦ÌM for recombinant rat NR2C, NR2D, NR2A and NR2B receptors respectively.




¡¡ AST AST-161-10mg PPT ¡Ú4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol¡Û¡ÚSubtype selective ER¦Á Agonist¡Û 10mg ¾È²ñ +4¡î 263717-53-9
¡¡
¡¡
¡¡
Potent, subtype selective ER¦Á estrogen receptor agonist. Over 400-fold selective for ER¦Á over ER¦Â receptors.




¡¡ AST AST-161-50mg PPT ¡Ú4,4',4''-(4-Propyl-[1H]-pyrazole-1,3,5-triyl)trisphenol¡Û¡ÚSubtype selective ER¦Á Agonist¡Û 50mg ¾È²ñ +4¡î 263717-53-9
¡¡
¡¡
¡¡
Potent, subtype selective ER¦Á estrogen receptor agonist. Over 400-fold selective for ER¦Á over ER¦Â receptors.




¡¡ AST AST-238-50mg Prazosin, HCl ¡Ú[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl¡Û¡Ú¦Á-Adrenoceptor Antagonist¡Û 50mg ¾È²ñ +4¡î 19237-84-4
¡¡
¡¡
¡¡
Peripheral ¦Á1- and ¦Á2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.




¡¡ AST AST-238-250mg Prazosin, HCl ¡Ú[4-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-1-piperazinyl]-2-furanylmethanone, HCl¡Û¡Ú¦Á-Adrenoceptor Antagonist¡Û 250mg ¾È²ñ +4¡î 19237-84-4
¡¡
¡¡
¡¡
Peripheral ¦Á1- and ¦Á2-adrenoceptor antagonist. Orally active vasodilator. Also melatonin MT3 antagonist.




¡¡ AST AST-334-1g Propofol ¡Ú2,6-Diisopropylphenol¡Û 1g ¾È²ñ RT 2078-54-8
¡¡
¡¡
¡¡
GABAA agonist. Short-acting intravenous anaesthetic agent. Stimulates constitutive nitric oxide (NO) production and inhibits inducible NO production. Also has anxiolytic properties, antioxidant, immun




¡¡ AST AST-304-1mg Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û 1mg ¾È²ñ +4¡î 212844-53-6
¡¡
¡¡
¡¡
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).




¡¡ AST AST-304-10mg Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û 10mg ¾È²ñ +4¡î 212844-53-6
¡¡
¡¡
¡¡
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).




¡¡ AST AST-304-50mg Purvalanol A ¡Ú(R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)-3-methylbutan-1-ol¡Û 50mg ¾È²ñ +4¡î 212844-53-6
¡¡
¡¡
¡¡
Potent CDK inhibitor (IC50 = 100 nM for CDK2/cyclin A). Also inhibits other kinases in the low micromolar range, including DYRK1A and RSK1 (IC50 values are 0.3 and 1.49 ¦ÌM respectively).




¡¡ AST AST-305-10mg Purvalanol B ¡Ú4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid¡Û 10mg ¾È²ñ +4¡î 212844-54-7
¡¡
¡¡
¡¡
Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas




¡¡ AST AST-305-50mg Purvalanol B ¡Ú4-(2-((R)-1-Hydroxy-3-methylbutan-2-ylamino)-9-isopropyl-9H-purin-6-ylamino)-2-chlorobenzoic Acid¡Û 50mg ¾È²ñ +4¡î 212844-54-7
¡¡
¡¡
¡¡
Potent CDK2 inhibitor, displaying an IC50 against the complex of CDK2-cyclin A of 6 nM. Shows selectivity over a range of other protein kinases including protein kinase C, Raf kinase, and casein kinas




¡¡ AST AST-247-100mg Quercetin ¡Ú2-(3,4-Dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one¡Û 100mg ¾È²ñ RT 6151-25-3
¡¡
¡¡
¡¡
Anti-oxidative flavonoid. Anticancer, antithrombotic and anti-inflammatory agent. Actions include inhibition of mitochondrial ATPase, phosphodiesterases, PI3-kinase and PIP kinase activity.




¡¡ AST AST-010-5mg Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û 5mg ¾È²ñ +4¡î 52809-07-1
¡¡
¡¡
¡¡
Potent group I mGlu agonist and AMPA receptor agonist.




¡¡ AST AST-010-10mg Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û 10mg ¾È²ñ +4¡î 52809-07-1
¡¡
¡¡
¡¡
Potent group I mGlu agonist and AMPA receptor agonist.




¡¡ AST AST-010-50mg Quisqualic Acid ¡ÚL-(+)-¦Á-Amino-3,5-dioxo-1,2,4-oxadiazolidine-2-propanoic Acid¡Û 50mg ¾È²ñ +4¡î 52809-07-1
¡¡
¡¡
¡¡
Potent group I mGlu agonist and AMPA receptor agonist.




¡¡ AST AST-126-10mg QX-222 ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û 10mg ¾È²ñ -20¡î 21236-55-5
¡¡
¡¡
¡¡
Na+ channel blocker. Lidocaine derivative.




¡¡ AST AST-126-50mg QX-222 ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)trimethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û 50mg ¾È²ñ -20¡î 21236-55-5
¡¡
¡¡
¡¡
Na+ channel blocker. Lidocaine derivative.




¡¡ AST AST-117-50mg QX-314 Bromide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide¡Û¡ÚNa+ Channel Blocker¡Û 50mg ¾È²ñ +4¡î 21306-56-9
¡¡
¡¡
¡¡
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.




¡¡ AST AST-117-100mg QX-314 Bromide ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Bromide¡Û¡ÚNa+ Channel Blocker¡Û 100mg ¾È²ñ +4¡î 21306-56-9
¡¡
¡¡
¡¡
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ conductance when applied intracellularly.




¡¡ AST AST-118-50mg QX-314 Chloride ¡ÚN-(2,6-Dimethylphenylcarbamoylmethyl)triethylammonium Chloride¡Û¡ÚNa+ Channel Blocker¡Û 50mg ¾È²ñ +4¡î 5369-03-9
¡¡
¡¡
¡¡
A membrane impermeable quaternary lidocaine derivative. Blocks voltage-sensitive Na+ channels




¡¡ AST AST-224-1mg Rapamycin ¡ÚImmunosuppressant¡Û 1mg ¾È²ñ -20¡î 53123-88-9
¡¡
¡¡
¡¡
Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin




¡¡ AST AST-224-5mg Rapamycin ¡ÚImmunosuppressant¡Û 5mg ¾È²ñ -20¡î 53123-88-9
¡¡
¡¡
¡¡
Immunosuppressant and antifungal agent . Complexes with FKBP-12 and inhibits mTOR (mammalian target of rapamycin). In complex with its cellular receptor, the FK506-binding protein (FKBP12), rapamycin




¡¡ AST AST-236-10mg Rasagiline Mesylate ¡Ú(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate¡Û 10mg ¾È²ñ +4¡î 161735-79-1
¡¡
¡¡
¡¡
Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti




¡¡ AST AST-236-50mg Rasagiline Mesylate ¡Ú(1R)-2,3-Dihydro-N-2-propyn-1-yl-1H-Inden-1-amine Methanesulfonate¡Û 50mg ¾È²ñ +4¡î 161735-79-1
¡¡
¡¡
¡¡
Selective, irreversible monoamine oxidase B (MAO-B) inhibitor, with anti-Parkinson activity. In cell culture (PC-12 and neuroblastoma SH-SY5Y cells) it exhibits neuroprotective and anti-apoptotic acti




¡¡ AST AST-157-10mg Reboxetine Mesylate ¡Ú(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine¡Û¡ÚNoradrenaline Reuptake Inhibitor¡Û 10mg ¾È²ñ +4¡î 71620-89-8
¡¡
¡¡
¡¡
Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.




¡¡ AST AST-157-50mg Reboxetine Mesylate ¡Ú(R*)-2-((R*)-(2-ethoxyphenoxy)(phenyl)methyl)morpholine¡Û¡ÚNoradrenaline Reuptake Inhibitor¡Û 50mg ¾È²ñ +4¡î 71620-89-8
¡¡
¡¡
¡¡
Potent, selective noradrenaline reuptake inhibitor, with high selectivity over dopamine and 5-HT transporters. Antidepressant in vivo.




¡¡ AST AST-272-10mg Riluzole ¡Ú2-Amino-6-trifluoromethoxybenzothiazole, HCl¡Û 10mg ¾È²ñ RT 1744-22-5
¡¡
¡¡
¡¡
Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,




¡¡ AST AST-272-50mg Riluzole ¡Ú2-Amino-6-trifluoromethoxybenzothiazole, HCl¡Û 50mg ¾È²ñ RT 1744-22-5
¡¡
¡¡
¡¡
Neuroprotective agent with anticonvulsant, sedative, anxiolytic, anti-ischemic and anesthetic properties. Inhibits glutamate release, enhances glutamate uptake, blocks voltage-dependent Na+ channels,




¡¡ AST AST-031-10mg (R)-(-)-Rolipram ¡Ú(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one¡Û 10mg ¾È²ñ +4¡î 85416-75-7
¡¡
¡¡
¡¡
Selective PDE4 inhibitor (IC50 = 0.22 ¦ÌM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.




¡¡ AST AST-031-50mg (R)-(-)-Rolipram ¡Ú(4R)-4-[3-(Cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one¡Û 50mg ¾È²ñ +4¡î 85416-75-7
¡¡
¡¡
¡¡
Selective PDE4 inhibitor (IC50 = 0.22 ¦ÌM). More active enantiomer: 2-10-fold more potent that the (S)-(+)-enantiomer.




¡¡ AST AST-029-10mg (R,S)-Rolipram ¡Ú(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û 10mg ¾È²ñ +4¡î 61413-54-5
¡¡
¡¡
¡¡
Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 ¦ÌM and 0.17 ¦ÌM for inhibition of mouse PDE4A1 and PDE4B respectively)




¡¡ AST AST-029-50mg (R,S)-Rolipram ¡Ú(R,S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û 50mg ¾È²ñ +4¡î 61413-54-5
¡¡
¡¡
¡¡
Selective cAMP-specific phosphodiesterase PDE4 inhibitor. (IC50 values are 1.1 ¦ÌM and 0.17 ¦ÌM for inhibition of mouse PDE4A1 and PDE4B respectively)




¡¡ AST AST-030-10mg (S)-(+)-Rolipram ¡Ú(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û 10mg ¾È²ñ +4¡î 85416-73-5
¡¡
¡¡
¡¡
PDE4 inhibitor (IC50 = 0.58 ¦ÌM). Less active enantiomer.




¡¡ AST AST-030-50mg (S)-(+)-Rolipram ¡Ú(S)-4-(3-(Cyclopentyloxy)-4-methoxyphenyl)pyrrolidin-2-one¡Û 50mg ¾È²ñ +4¡î 85416-73-5
¡¡
¡¡
¡¡
PDE4 inhibitor (IC50 = 0.58 ¦ÌM). Less active enantiomer.




¡¡ AST AST-290-1mg Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û 1mg ¾È²ñ RT 169274-78-6
¡¡
¡¡
¡¡
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant




¡¡ AST AST-290-10mg Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û 10mg ¾È²ñ RT 169274-78-6
¡¡
¡¡
¡¡
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant




¡¡ AST AST-290-50mg Ro 25-6981 Maleate ¡Ú[R-(R*,S*)]-a-(4-Hydroxyphenyl)-?-methyl-4-(phenylmethyl)-1-piperidinepropanol Maleate¡Û 50mg ¾È²ñ RT 169274-78-6
¡¡
¡¡
¡¡
Potent, highly selective, activity-dependent blocker of NMDA receptors that contain the NR2B subunit (IC50 values are 0.009 and 52 ¦ÌM at NR1C/NR2B and NR1C/NR2A respectively). Displays no significant




¡¡ AST AST-264-100mg Ruthenium Red 100mg ¾È²ñ RT 11103-72-3
¡¡
¡¡
¡¡
Inhibitor of calcium signalling with multiple actions. Inhibits the mitochondrial Ca2+ uniporter, Ca2+-ATPase, troponin C and calmodulin. Attenuates capsaicin-induced cation channel opening. Inhibits




¡¡ AST AST-083-1mg Ryanodine ¡Ú1H-Pyrrole-2-carboxylic Acid, (3S,4R,4¦ÁR,6S,7S,8R,8¦ÁS,8¦ÂR,9S,9¦ÁS)-Dodecahydro-4,6,7,8¦Á,8¦Â,9¦Á-hexahydroxy- 3,6¦Á,9-trimethyl-7-(1-methylethyl)-6,9-methanobenzo[1,2] pentaleno[1,6-bc 1mg ¾È²ñ -20¡î 15662-33-6
¡¡
¡¡
¡¡
Alkaloid that binds with high affinity to ryanodine receptors to modulate intracellular Ca2+ release. Has complex actions and may stimulate or inhibit Ca2+ release, depending on the concentration used




¡¡ AST AST-327-10mg Saclofen ¡Ú3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid¡Û 10mg ¾È²ñ RT 125464-42-8
¡¡
¡¡
¡¡
GABAB antagonist




¡¡ AST AST-327-50mg Saclofen ¡Ú3-Amino-2-(4-chlorophenyl)propane-1-sulfonic Acid¡Û 50mg ¾È²ñ RT 125464-42-8
¡¡
¡¡
¡¡
GABAB antagonist




¡¡ AST AST-084 Salvinorin A <<< Í¢Æþ¶Ø?ß >>> ¾È²ñ 83729-01-5
¡¡
¡¡
¡¡
Potent ¦Ê agonist (Ki = 8-19 nM). Psychoactive and antinociceptive in vivo. Reported to be an allosteric modulator of ¦Ì opiod receptors.




¡¡ AST AST-182-1mg SAMS peptide ¡ÚAMP-activated Protein Kinase Substrate¡Û 1mg ¾È²ñ -20¡î 125911-68-4
¡¡
¡¡
¡¡
Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR




¡¡ AST AST-182-5mg SAMS peptide ¡ÚAMP-activated Protein Kinase Substrate¡Û 5mg ¾È²ñ -20¡î 125911-68-4
¡¡
¡¡
¡¡
Substrate for AMP-activated protein kinase Amino Acids Sequence:HMRSAMSGLHLVKRR




¡¡ AST AST-162-1mg SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û 1mg ¾È²ñ +4¡î 152121-47-6
¡¡
¡¡
¡¡
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.




¡¡ AST AST-162-10mg SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û 10mg ¾È²ñ +4¡î 152121-47-6
¡¡
¡¡
¡¡
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.




¡¡ AST AST-162-50mg SB 203580 ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine¡Û 50mg ¾È²ñ +4¡î 152121-47-6
¡¡
¡¡
¡¡
Cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.




¡¡ AST AST-202-1mg SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û 1mg ¾È²ñ +4¡î 280744-09-4
¡¡
¡¡
¡¡
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra




¡¡ AST AST-202-10mg SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û 10mg ¾È²ñ +4¡î 280744-09-4
¡¡
¡¡
¡¡
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra




¡¡ AST AST-202-50mg SB 216763 ¡Ú3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione¡Û 50mg ¾È²ñ +4¡î 280744-09-4
¡¡
¡¡
¡¡
Potent and selective glycogen synthase kinase-3 (GSK-3) inhibitor (Ki = 9 nM for GSK-3¦Á). Has little activity against 24 other protein kinases (IC50 > 10 ¦ÌM). Stimulates glycogen synthesis, gene tra




¡¡ AST AST-163-1mg SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û 1mg ¾È²ñ RT 301836-41-9
¡¡
¡¡
¡¡
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.




¡¡ AST AST-163-10mg SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û 10mg ¾È²ñ RT 301836-41-9
¡¡
¡¡
¡¡
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.




¡¡ AST AST-163-50mg SB431542 ¡Ú4-[4-(3,4-Methylenedioxyphenyl)-5-(2-pyridyl)-1H-imidazol-2-yl]benzamide¡Û 50mg ¾È²ñ RT 301836-41-9
¡¡
¡¡
¡¡
Potent and selective inhibitor of Activin Like Kinase. Inhibits ALK 4, 5 (IC50 = 94 nM), and 7.




¡¡ AST AST-235-10mg SB 203580, HCl ¡Ú4-[4-(4-Fluorophenyl)-2-[4-(methylsulfinyl)phenyl]-1H-imidazol-5-yl]pyridine, HCl¡Û¡Úp38 MAP Kinase Inhibitor; water soluble¡Û 10mg ¾È²ñ +4¡î 152121-47-6 (free base)
¡¡
¡¡
¡¡
Water soluble, cell permeable p38 MAP kinase inhibitor. Shows selectivity over many other kinases but also shown to have some inhibitory activity against GAK, CK1 , RIP2 c-Raf and GSK3.




¡¡ AST AST-062-10mg (S)-5-Chlorowillardiine ¡Ú(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚAMPA / Kainate Agonist¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent AMPA / kainate receptor agonist




¡¡ AST AST-062-50mg (S)-5-Chlorowillardiine ¡Ú(S)-2-Amino-3-(5-chloro-3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û¡ÚAMPA / Kainate Agonist¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent AMPA / kainate receptor agonist




¡¡ AST AST-048-1g D-Serine ¡Ú(R)-2-Amino-3-hydroxypropanoic Acid¡Û 1g ¾È²ñ +4¡î 56-45-1
¡¡
¡¡
¡¡
Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.




¡¡ AST AST-048-5g D-Serine ¡Ú(R)-2-Amino-3-hydroxypropanoic Acid¡Û 5g ¾È²ñ +4¡î 56-45-1
¡¡
¡¡
¡¡
Agonist at the NMDA glycine binding site and the inhibitory post-synaptic glycine receptor.




¡¡ AST AST-280-10mg SKF 96365 ¡Ú1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl¡Û 10mg ¾È²ñ RT 130495-35-1
¡¡
¡¡
¡¡
Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .




¡¡ AST AST-280-50mg SKF 96365 ¡Ú1-[2-[3-(4-Methoxyphenyl)propoxy]-2-(4-methoxyphenyl)ethyl]-1H-imidazole, HCl¡Û 50mg ¾È²ñ RT 130495-35-1
¡¡
¡¡
¡¡
Blocker of TRP cation channels. Inhibits capacitative Ca2+ entry .




¡¡ AST AST-250-10mg SKF 97541 ¡Ú3-Aminopropyl(methyl)phosphinic Acid¡Û 10mg ¾È²ñ RT 127729-35-5
¡¡
¡¡
¡¡
Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 ¦ÌM for SKF97541 and baclofen respectively.




¡¡ AST AST-250-50mg SKF 97541 ¡Ú3-Aminopropyl(methyl)phosphinic Acid¡Û 50mg ¾È²ñ RT 127729-35-5
¡¡
¡¡
¡¡
Highly potent GABAB agonist, 10-fold more potent than Baclofen (Asc-149). EC50 values for depression of striatal synaptic potentials are 920 nM and 1.25 ¦ÌM for SKF97541 and baclofen respectively.




¡¡ AST AST-326-10£í£ç SKF 89976A, HCl ¡Ú1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl¡Û 10mg ¾È²ñ +4¡î 85375-15-1
¡¡
¡¡
¡¡
A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 ¦ÌM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu




¡¡ AST AST-326-50mg SKF 89976A, HCl ¡Ú1-(4,4-Diphenyl-3-butenyl)-3-piperidinecarboxylic Acid, HCl¡Û 50mg ¾È²ñ +4¡î 85375-15-1
¡¡
¡¡
¡¡
A potent GABA uptake inhibitor, highly selective for GAT-1 (IC50 values are 0.13, 550, 944 and 7210 ¦ÌM for hGAT-1, rGAT-2, hGAT-3 and hBGT-1 respectively). Brain penetrant, orally active and anticovu




·àʪ AST AST-082-10mg SL 327 ¡Ú¦Á-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile¡Û 10mg ¾È²ñ +4¡î 305350-87-2
¡¡
¡¡
¡¡
Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 ¦ÌM and 0.22 ¦ÌM respectively).




·àʪ AST AST-082-25mg SL 327 ¡Ú¦Á-[Amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)benzeneacetonitrile¡Û 25mg ¾È²ñ +4¡î 305350-87-2
¡¡
¡¡
¡¡
Centrally active, brain penetrant selective MEK1 and MEK2 inhibitor (IC50 values in in vitro assays are 0.18 ¦ÌM and 0.22 ¦ÌM respectively).




¡¡ AST AST-176-1mg SLIGRL-NH2 ¡ÚPAR2 Agonist Peptide¡Û 1mg ¾È²ñ -20¡î 171436-38-7
¡¡
¡¡
¡¡
Proteinase-activated receptor-2 activating (PAR2) agonist peptide. Amino Acids Sequence:SLIGRL-NH2




¡¡ AST AST-014-10mg SNAP ¡ÚS-Nitroso-N-acetyl-DL-penicillamine¡Û 10mg ¾È²ñ -20¡î 67776-06-1
¡¡
¡¡
¡¡
NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.




¡¡ AST AST-014-50mg SNAP ¡ÚS-Nitroso-N-acetyl-DL-penicillamine¡Û 50mg ¾È²ñ -20¡î 67776-06-1
¡¡
¡¡
¡¡
NO donor. Vasodilator in vitro and in vivo, that does not induce pharmacological tolerance.




¡¡ AST AST-259-10ug SNX 482 10ug ¾È²ñ -20¡î 203460-30-4
¡¡
¡¡
¡¡
Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (¦Á1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent




¡¡ AST AST-259-0.1mg SNX 482 0.1mg ¾È²ñ -20¡î 203460-30-4
¡¡
¡¡
¡¡
Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (¦Á1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concent




¡¡ AST AST-065-10mg SP600125 ¡Ú1,9-Pyrazoloanthrone¡Û 10mg ¾È²ñ +4¡î 129-56-6
¡¡
¡¡
¡¡
Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 ¦ÌM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the




¡¡ AST AST-065-50mg SP600125 ¡Ú1,9-Pyrazoloanthrone¡Û 50mg ¾È²ñ +4¡î 129-56-6
¡¡
¡¡
¡¡
Potent and selective JNK1, -2, and -3 inhibitor (IC50=0.11 ¦ÌM). SP600125 is a reversible ATP competitive inhibitor with >20 fold selectivity over a range of kinases. It dose-dependently inhibits the




¡¡ AST AST-057-100mg Spermidine, 3HCl ¡ÚN-(3-Aminopropyl)butane-1,4-diamine, 3HCl¡Û 100mg ¾È²ñ +4¡î 334-50-9
¡¡
¡¡
¡¡
Endogenous polyamine, that binds to the polyamine modulatory site of the NMDA receptor. Inhibits neuronal nitric oxide synthase (nNOS). Binds and precipitates DNA; may be used for purification of DNA




¡¡ AST AST-051-100mg Spermine ¡ÚN1,N4-bis(3-Aminopropyl)butane-1,4-diamine¡Û 100mg ¾È²ñ +4¡î 77-44-3
¡¡
¡¡
¡¡
Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.




¡¡ AST AST-051-1g Spermine ¡ÚN1,N4-bis(3-Aminopropyl)butane-1,4-diamine¡Û 1g ¾È²ñ +4¡î 77-44-3
¡¡
¡¡
¡¡
Endogenous polyamine, implicated in growth, differentiation, cell viability and apoptosis. Mixed NMDA glutamate receptor agonist / antagonist at the polyamine site.




¡¡ AST AST-042-10mg SR95531 ¡ÚGabazine¡Û¡Ú2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide¡Û 10mg ¾È²ñ +4¡î 104105-50-9
¡¡
¡¡
¡¡
Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.




¡¡ AST AST-042-50mg SR95531 ¡ÚGabazine¡Û¡Ú2-(3-Carboxypropyl)-3-amino-6-(4 methoxyphenyl)pyridazinium Bromide¡Û 50mg ¾È²ñ +4¡î 104105-50-9
¡¡
¡¡
¡¡
Selective, competitive GABAA receptor antagonist. Allosteric inhibitor of channel opening of the GABAA receptor. Displaces [3H]-GABA from rat brain membranes with a Ki of 150 nM.




¡¡ AST AST-056-0.1mg Staurosporine ¡Ú[9S-(9¦Á,10¦Â,11¦Â,13¦Á)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3¡Ç,2¡Ç,1¡Ç-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one¡Û 0.1mg ¾È²ñ +4¡î 62996-74-1
¡¡
¡¡
¡¡
Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)




¡¡ AST AST-056-0.5mg Staurosporine ¡Ú[9S-(9¦Á,10¦Â,11¦Â,13¦Á)]-2,3,10,11,12,13-Hexahydro-10-methoxy-9-methyl -11-(methylamino)-9,13-epoxy-1H,9H-diindolo[1,2,3-gh:3¡Ç,2¡Ç,1¡Ç-1m]pyrrolo[3,4-j][1,7]benzodiazonin-1- one¡Û 0.5mg ¾È²ñ +4¡î 62996-74-1
¡¡
¡¡
¡¡
Potent, cell permeable, broad spectrum inhibitor of protein kinases. Kinases inhibited include: protein kinase C (IC50 = 3 nM), cAMP-dependent protein kinase (IC50 = 8 nM), and p60v-src (IC50 = 6 nM)




¡¡ AST AST-170-1mg Substanvce P ¡ÚSensory Neuropeptide¡Û 1mg ¾È²ñ -20¡î 33507-63-0
¡¡
¡¡
¡¡
Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2




¡¡ AST AST-170-5mg Substanvce P ¡ÚSensory Neuropeptide¡Û 5mg ¾È²ñ -20¡î 33507-63-0
¡¡
¡¡
¡¡
Sensory neuropeptide and inflammatory mediator involved in pain transmission. Amino Acids Sequence:RPKPQQFFGLM-NH2




¡¡ AST AST-090 DL-TBOA ¡ÚDL-threo-¦Â-Benzyloxyaspartic Acid¡Û - - - Discontinued ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
Potent, competitive, non-transportable EAAT inhibitor (IC50 values are 48, 7 and 8 ¦ÌM at EAAT1-3 respectively). Neurotoxic and convulsant in vivo.




¡¡ AST AST-276-100mg tBuBHQ ¡Ú2,5-Di-tert-butylhydroquinone¡Û 100mg ¾È²ñ RT 88-58-4
¡¡
¡¡
¡¡
Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor




¡¡ AST AST-276-500mg tBuBHQ ¡Ú2,5-Di-tert-butylhydroquinone¡Û 500mg ¾È²ñ RT 88-58-4
¡¡
¡¡
¡¡
Sarco-endoplasmic reticulum Ca2+ ATPase (SERCA) inhibitor




¡¡ AST AST-270-100mg Terfenadin ¡Ú1-(4-tert-Butylphenyl)-4-[4-(hydroxydiphenylmethyl)piperidin-1-yl]butan-1-ol¡Û 100mg ¾È²ñ +4¡î 50679-08-8
¡¡
¡¡
¡¡
K+ channel blocker (Kv11.1). Blocks ATP-sensitive K+ channels (IC50 = 1.2 ¦ÌM). H1 receptor antagonist.




¡¡ AST AST-275-50mg N,N,N,N-Tetraethylammonium Chloride ¡ÚTEA¡Û 50mg ¾È²ñ RT 56-34-8
¡¡
¡¡
¡¡
Non-selective K+ channel blocker (6TM family of K+ channels).




¡¡ AST AST-054-1mg Tetrodotoxin ¡ÚOctahydro-12-(hydroxymethyl)-2-imino-5,9:7,10¦Á-dimethano-10¦ÁH-[1,3]dioxocino[6,5-d]pyrimidine-4,7,10,11,12-pentol¡Û 1mg ¾È²ñ -20¡î 4368-28-9
¡¡
¡¡
¡¡
Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.




¡¡ AST AST-055-1mg Tetrodotoxin Citrate 1mg ¾È²ñ -20¡î 18660-81-6
¡¡
¡¡
¡¡
Water soluble citrate salt of tetrodotoxin. Potent, selective and reversible, use-dependent inhibitor of voltage-dependent Na+ channels.




¡¡ AST AST-177-1mg TFLLR-NH2 ¡ÚPAR1 Agonist Peptide¡Û 1mg ¾È²ñ -20¡î 197794-83-5
¡¡
¡¡
¡¡
Proteinase-activated receptor-1 activating (PAR1) agonist peptide. Amino Acids Sequence:TFLLR-NH2




¡¡ AST AST-032-100mg (+/-)-Thalidomide ¡ÚN-(2,6-Dioxo-3-piperidinyl)phthalimide¡Û 100mg ¾È²ñ +4¡î 50-35-1
¡¡
¡¡
¡¡
Immunomodulator. Antiproliferative, anti-angiogenic and pro-apoptotic.




¡¡ AST AST-286-1mg Thapsigargin 1mg ¾È²ñ -20¡î 67526-95-8
¡¡
¡¡
¡¡
A potent, cell-permeable Ca2+-ATPase inhibitor. Releases Ca2+ by inhibiting endoplasmic reticular Ca2+-ATPase (IC50 = 4-13 nM). Both tumorogenic and apoptotic actions reported.




¡¡ AST AST-155-10mg L-Thio-AP4 ¡Ú(2S)-2-Amino-4-(hydroxymercaptophosphinyl)butanoic Acid¡Û - - - Discontinued 10mg ¾È²ñ +4¡î 373644-25-8
¡¡
¡¡
¡¡
Potent Group III mGlu agonist - two-fold more potent than L-AP4. EC50 values are 0.039, 0.73, 197, 0.054 ¦ÌM at mGlu4, 6, 7, 8 respectively.




¡¡ AST AST-021-10mg Thioperamide Maleate ¡ÚN-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate¡Û 10mg ¾È²ñ +4¡î 106243-16-7
¡¡
¡¡
¡¡
Potent, selective H3 antagonist that crosses the blood-brain barrier.




¡¡ AST AST-021-50mg Thioperamide Maleate ¡ÚN-Cyclohexyl-4-(imidazol-4-yl)-1-piperidinecarbothioamide Maleate¡Û 50mg ¾È²ñ +4¡î 106243-16-7
¡¡
¡¡
¡¡
Potent, selective H3 antagonist that crosses the blood-brain barrier.




¡¡ AST AST-237-10mg Tiagabine, HCl ¡Ú(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl¡Û 10mg ¾È²ñ +4¡î 115103-54-3 (free base)
¡¡
¡¡
¡¡
GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.




¡¡ AST AST-237-50mg Tiagabine, HCl ¡Ú(3R)-1-[4,4-Bis(3-methyl-2-thienyl)-3-buten-1-yl]-3-piperidinecarboxylic Acid, HCl¡Û 50mg ¾È²ñ +4¡î 115103-54-3 (free base)
¡¡
¡¡
¡¡
GABA uptake inhibitor, selective for GAT-1. Anticonvulsant in vivo.




¡¡ AST AST-289-10mg TMCB ¡Ú2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid¡Û 10mg ¾È²ñ RT 905105-89-7
¡¡
¡¡
¡¡
CK2 inhibitor (Ki = 0.25 ¦ÌM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 ¦ÌM respectively) and a more favourable




¡¡ AST AST-289-50mg TMCB ¡Ú2-(4,5,6,7-Tetrabromo-2-(dimethylamino)-1H-benzo[d]imidazol-1-yl)acetic Acid¡Û 50mg ¾È²ñ RT 905105-89-7
¡¡
¡¡
¡¡
CK2 inhibitor (Ki = 0.25 ¦ÌM), more selective than DMAT. Unlike DMAT, TMCB displays selectivity over PIM1, HIPK2 and DYRK1a (Ki values are 8.65, 15.25 and 11.90 ¦ÌM respectively) and a more favourable




¡¡ AST AST-278-100mg Tolubutamide ¡Ú1-Butyl-3-tosylurea¡Û 100mg ¾È²ñ RT 64-77-7
¡¡
¡¡
¡¡
Blocker of ATP-sensitive (KIR6.x) inward rectifier K+ channels.




¡¡ AST AST-156-10mg Tropisetron, HCl ¡Ú(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl¡Û¡Ú5-HT3 Antagonist¡Û 10mg ¾È²ñ RT 105826-92-4
¡¡
¡¡
¡¡
5HT3 agonist. Potent, orally active anti-emetic. Also ¦Á7 nicotinic receptor partial agonist.




¡¡ AST AST-156-50mg Tropisetron, HCl ¡Ú(3-endo)-8-Methyl-8-aza-bicyclo[3.2.1]octan-3-yl 1H-indole-3-carboxylate, HCl¡Û¡Ú5-HT3 Antagonist¡Û 50mg ¾È²ñ RT 105826-92-4
¡¡
¡¡
¡¡
5HT3 agonist. Potent, orally active anti-emetic. Also ¦Á7 nicotinic receptor partial agonist.




·àʪ AST AST-073-10mg (+)-Tubocurarine ¡Ú(+)-Tubocurarine chloride¡Û¡ÚACh Receptor Antagonist¡Û 10mg ¾È²ñ +4¡î 57-94-3
¡¡
¡¡
¡¡
Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis




·àʪ AST AST-073-50mg (+)-Tubocurarine ¡Ú(+)-Tubocurarine chloride¡Û¡ÚACh Receptor Antagonist¡Û 50mg ¾È²ñ +4¡î 57-94-3
¡¡
¡¡
¡¡
Nicotinic acetylcholine receptor competitive antagonist. Muscle relaxant, can be used to induce neuromuscular paralysis




¡¡ AST AST-296-10mg Tunicamycin from Streptomyces sp. 10mg ¾È²ñ +4¡î 11089-65-9
¡¡
¡¡
¡¡
Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho




¡¡ AST AST-296-50mg Tunicamycin from Streptomyces sp. 50mg ¾È²ñ +4¡î 11089-65-9
¡¡
¡¡
¡¡
Nucleoside antibiotic that inhibits protein glycosylation. Inhibits GlcNAc phosphotransferase (GPT) and inhibits the transfer of N-acetylglucosamine-1-phosphate from UDP-N-acetylglucosamine to dolicho




·àʪ AST AST-241-5mg U0126 ¡Ú1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene¡Û¡ÚSelective MKK Inhibitor¡Û 5mg ¾È²ñ +4¡î 109511-58-2
¡¡
¡¡
¡¡
Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 ¦ÌM respectively) and MKK5 with little or no effect on a wide range of other kinases.




·àʪ AST AST-241-25mg U0126 ¡Ú1,4-Diamino-2,3-dicyano-1,4-bis(2-aminophenylthio)butadiene¡Û¡ÚSelective MKK Inhibitor¡Û 25mg ¾È²ñ +4¡î 109511-58-2
¡¡
¡¡
¡¡
Selective non-competitive inhibitor of MAP kinase kinase (MKK). Inhibits MKK1, MKK2 (IC50 values of 0.07 and 0.06 ¦ÌM respectively) and MKK5 with little or no effect on a wide range of other kinases.




¡¡ AST AST-101-10mg U 93631 ¡Útert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate¡Û 10mg ¾È²ñ RT 152273-12-6
¡¡
¡¡
¡¡
GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c




¡¡ AST AST-101-50mg U 93631 ¡Útert-Butyl 4,5-Dihydro-4,4-dimethylimidazo[1,5-a]quinoxaline-3-carboxylate¡Û 50mg ¾È²ñ RT 152273-12-6
¡¡
¡¡
¡¡
GABAA antagonist that interacts with the picrotoxin site and stabilises the GABAA receptor/Cl- channel complex in an inactivated state. Causes rapid decay of gamma-aminobutyric acid-induced chloride c




¡¡ AST AST-193-10mg UBP141 ¡Ú(2R*,3S*)-1-(Phenanthrenyl-3-carbonyl)piperazine-2,3-dicarboxylic Acid¡Û¡ÚNR2D Antagonist, with some subunit selectivity¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
NR2D antagonist, displaying modest subunit selectivity. Shows 7-fold selectivity for NR2C and/or NR2D-containing NMDA receptors and 5-fold selectivity over NR2A-containing receptors.




¡¡ AST AST-194-10mg UBP304 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione¡Û¡ÚPotent, selective GLUK5 Receptor Antagonist¡Û 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Potent, selective GLUK5 receptor antagonist (Kd = 105 nM). Selective over homomeric GLUK6, GLUK7 and GLUA1-4 AMPA receptors (IC50 >100 ¦ÌM), and displays over 500-fold selectivity over NMDA or Group I




¡¡ AST AST-195-10mg UBP308 ¡Ú(R)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxythiophen-3-ylmethyl)pyrimidine-2,4-dione¡Û¡ÚInactive Isomer of the GLUK5 Receptor Antagonist UBP304¡Û 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Inactive isomer of the potent, selective GLUK5 receptor antagonist UBP 304 (#Asc-194).




¡¡ AST AST-168-10mg UBP310 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione¡Û 10mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 ¦ÌM at recombinant human GLUA2 (formerly




¡¡ AST AST-168-50mg UBP310 ¡Ú(S)-1-(2-Amino-2-carboxyethyl)-3-(2-carboxy-thiophene-3-yl-methyl)-5-methylpyrimidine-2,4-dione¡Û 50mg ¾È²ñ +4¡î none
¡¡
¡¡
¡¡
GluK1 (formerly GluR5) and GluK3 (formerly GluR7) receptor selective antagonist (Kb value of 10 nM and IC50 value of 23 nM, respectively). IC50 values are >100 ¦ÌM at recombinant human GLUA2 (formerly




·àʪ AST AST-309-1mg UCPH-101 ¡Ú2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile¡Û 1mg ¾È²ñ +4¡î 1118460-77-7
¡¡
¡¡
¡¡
Potent, selective inhibitor of EAAT1 (IC50 = 0.66 ¦ÌM ). Displays >400-fold selectivity over EAAT2 and EAAT3.




¡¡ AST AST-309-10mg UCPH-101 ¡Ú2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile¡Û 10mg ¾È²ñ +4¡î 1118460-77-7
¡¡
¡¡
¡¡
Potent, selective inhibitor of EAAT1 (IC50 = 0.66 ¦ÌM ). Displays >400-fold selectivity over EAAT2 and EAAT3.




¡¡ AST AST-175-1mg (Arg-8)-Vasopressin ¡ÚVasopressin Receptor Agonist¡Û 1mg ¾È²ñ -20¡î 113-79-1
¡¡
¡¡
¡¡
Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence¡§CYFQNCPRG-NH2 disulfide bridge 1-6




¡¡ AST AST-175-5mg (Arg-8)-Vasopressin ¡ÚVasopressin Receptor Agonist¡Û 5mg ¾È²ñ -20¡î 113-79-1
¡¡
¡¡
¡¡
Endogenous peptide neurotransmitter, involved in water regulation and vasodepression. Amino Acids Sequence¡§CYFQNCPRG-NH2 disulfide bridge 1-6




·àʪ AST AST-140-1g Verapamil, HCl ¡ÚL-type Ca2+ Channel Blocker¡Û 1g ¾È²ñ RT 152-11-4
¡¡
¡¡
¡¡
L-type Ca2+ channel blocker. Antiarrhythmic in vivo.




¡¡ AST AST-279-10mg Veratridine 10mg ¾È²ñ -20¡î 71-62-5
¡¡
¡¡
¡¡
Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.




¡¡ AST AST-279-50mg Veratridine 50mg ¾È²ñ -20¡î 71-62-5
¡¡
¡¡
¡¡
Alkaloid toxin found in Liliaceae plants. Causes persistent opening of the voltage-gated Na+ channel and reduces its single-channel conductance. Channel opener.




¡¡ AST AST-226-5mg Vincristine Sulfate 5mg ¾È²ñ -20¡î 2068-78-2
¡¡
¡¡
¡¡
Anticancer agent; microtubule disrupter.




¡¡ AST AST-226-25mg Vincristine Sulfate 25mg ¾È²ñ -20¡î 2068-78-2
¡¡
¡¡
¡¡
Anticancer agent; microtubule disrupter.




¡¡ AST AST-180-1mg VIP (6-28) ¡ÚVPAC Antagonist¡Û 1mg ¾È²ñ -20¡î 69698-54-0
¡¡
¡¡
¡¡
VPAC antagonist. Amino Acids Sequence:FTDNYTRLRKQMAVKKYLNSILN-NH2




¡¡ AST AST-244-10mg VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and




¡¡ AST AST-244-50mg VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û 50mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is water soluble and




¡¡ AST AST-248-10mg VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û, Na salt 10mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat




¡¡ AST AST-248-50mg VU 0155041 ¡Úcis-2-(3,5-Dichlorophenylcarbamoyl)cyclohexanecarboxylic Acid¡Û¡ÚPAM for mGluR4¡Û, Na salt 50mg ¾È²ñ RT none
¡¡
¡¡
¡¡
Water soluble, positive allosteric selective modulator at mGluR4 (EC50 values are 798 nM and 693 nM at human and rat mGluR4 receptors respectively). It has advantages over PHCCC (Asc-043) as it is wat




¡¡ AST AST-165-10mg 1400W ¡ÚN-(3-(Aminomethyl)benzyl)acetamidine, 2HCl¡Û 10mg ¾È²ñ +4¡î 180001-34-7
¡¡
¡¡
¡¡
Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 ¦ÌM and 50 ¦ÌM at human iNOS, nNOS and eNOS respectively).




¡¡ AST AST-165-50mg 1400W ¡ÚN-(3-(Aminomethyl)benzyl)acetamidine, 2HCl¡Û 50mg ¾È²ñ +4¡î 180001-34-7
¡¡
¡¡
¡¡
Selective iNOS inhibitor, 5000-fold selective over eNOS (Kd values are =7 nM, 2 ¦ÌM and 50 ¦ÌM at human iNOS, nNOS and eNOS respectively).




¡¡ AST AST-040-10mg (S)-Willardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 10mg ¾È²ñ +4¡î 21416-43-3
¡¡
¡¡
¡¡
Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 ¦ÌM) over hGluR2 (Ki = 0.90 ¦ÌM); hGluR4 (Ki = 8.85 ¦ÌM) and Kainate receptor hGluR5 (Ki = 28.9 ¦ÌM). Produces strong desensitisation.




¡¡ AST AST-040-50mg (S)-Willardiine ¡Ú(S)-2-Amino-3-(3,4-dihydro-2,4-dioxopyrimidin-1(2H)-yl)propanoic Acid¡Û 50mg ¾È²ñ +4¡î 21416-43-3
¡¡
¡¡
¡¡
Selective AMPA receptor agonist at hGluR1 (Ki = 0.39 ¦ÌM) over hGluR2 (Ki = 0.90 ¦ÌM); hGluR4 (Ki = 8.85 ¦ÌM) and Kainate receptor hGluR5 (Ki = 28.9 ¦ÌM). Produces strong desensitisation.




¡¡ AST AST-148-1mg Wortmannin ¡ÚPI3-Kinase Inhibitor¡Û 1mg ¾È²ñ -20¡î 19545-26-7
¡¡
¡¡
¡¡
Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)




¡¡ AST AST-148-5mg Wortmannin ¡ÚPI3-Kinase Inhibitor¡Û 5mg ¾È²ñ -20¡î 19545-26-7
¡¡
¡¡
¡¡
Potent, selective and cell permeable inhibitor of phosphatidylinositol-3-kinase (PI3-kinase) (IC50 ~ 3 nM)




¡¡ AST AST-089-10mg XE-991, 2HCl ¡Ú10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl¡Û 10mg ¾È²ñ +4¡î 122955-42-4
¡¡
¡¡
¡¡
Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 ¦ÌM (M-current), 0.71 ¦ÌM (KCNQ 2), 0.75 ¦ÌM (KCNQX 1), >100 ¦ÌM (Kv1.2) and >43 ¦ÌM (Kv4.




¡¡ AST AST-089-50mg XE-991, 2HCl ¡Ú10,10-bis(4-Pyridinylmethyl)-9(10H)-anthracenone, 2HCl¡Û 50mg ¾È²ñ +4¡î 122955-42-4
¡¡
¡¡
¡¡
Potent and selective blocker of KCNQ voltage-gated potassium channels. Blocks M current. IC50 values are 0.98 ¦ÌM (M-current), 0.71 ¦ÌM (KCNQ 2), 0.75 ¦ÌM (KCNQX 1), >100 ¦ÌM (Kv1.2) and >43 ¦ÌM (Kv4.




¡¡ AST AST-129-1mg Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û 1mg ¾È²ñ +4¡î 146986-50-7
¡¡
¡¡
¡¡
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.




¡¡ AST AST-129-10mg Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û 10mg ¾È²ñ +4¡î 146986-50-7
¡¡
¡¡
¡¡
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.




¡¡ AST AST-129-50mg Y-27632, 2HCl ¡Ú(R)-(+)-trans-4-(1-Aminoethyl)-N-(4-Pyridyl)cyclohexanecarboxamide, 2HCl¡Û¡ÚSelective Rho Kinase Inhibitor¡Û 50mg ¾È²ñ +4¡î 146986-50-7
¡¡
¡¡
¡¡
Potent, selective Rho kinase inhibitor. Ki values are 0.22, 0.30, 73, 25, >250 ¦ÌM for ROCKI, ROCKII, PKC¦Á, PKA and MLCK respectively. Muscle relaxant. Systemically active antinociceptive.




¡¡ AST AST-293-10mg YM 202074 ¡ÚN-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 10mg ¾È²ñ +4¡î 299900-83-7
¡¡
¡¡
¡¡
Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.




¡¡ AST AST-293-50mg YM 202074 ¡ÚN-Cyclohexyl-6-[[(2-methoxyethyl)methylamino]methyl]-N-methyl-thiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 50mg ¾È²ñ +4¡î 299900-83-7
¡¡
¡¡
¡¡
Potent, selective allosteric mGluR1 antagonist. Binds to an allosteric site of rat mGluR1 with a Ki value of 4.8 nM. Neuroprotective in vivo.




¡¡ AST AST-015-10mg YM298198 ¡Ú6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 10mg ¾È²ñ +4¡î 748758-45-4
¡¡
¡¡
¡¡
Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 ¦ÌM). Orally active analgesic in vivo.




¡¡ AST AST-015-50mg YM298198 ¡Ú6-Amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide¡Û 50mg ¾È²ñ +4¡î 748758-45-4
¡¡
¡¡
¡¡
Potent, selective, water-soluble, non-competitive mGlu1 antagonist (IC50 = 16 nM) Selective over mGlu2,3,4,5,6, and 7 and ionotropic receptors (IC50 > 10 ¦ÌM). Orally active analgesic in vivo.




¡¡ AST AST-239-1g Yohimbine, HCl ¡Ú(16¦Á,17¦Á)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl¡Û 1g ¾È²ñ RT 65-19-0
¡¡
¡¡
¡¡
Selective ¦Á2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human ¦Á2A, ¦Á2B and ¦Á2C receptors respectively).




¡¡ AST AST-239-5g Yohimbine, HCl ¡Ú(16¦Á,17¦Á)-17-Hydroxy-yohimban-16-carboxylic Acid Methyl Ester, HCl¡Û 5g ¾È²ñ RT 65-19-0
¡¡
¡¡
¡¡
Selective ¦Á2-adrenoceptor antagonist (pKi values are 8.52, 8.00 and 9.17 for human ¦Á2A, ¦Á2B and ¦Á2C receptors respectively).




¡¡ AST AST-102-10mg ZD7288 ¡ÚICI D7288¡Û¡Ú4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride¡Û 10mg ¾È²ñ +4¡î 133059-99-1
¡¡
¡¡
¡¡
Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.




¡¡ AST AST-102-50mg ZD7288 ¡ÚICI D7288¡Û¡Ú4-Ethylphenylamino-1,2-dimethyl-6-methylaminopyrimidinium Chloride¡Û 50mg ¾È²ñ +4¡î 133059-99-1
¡¡
¡¡
¡¡
Sino-atrial node function modulator; blocks the hyperpolarisation activated inward current If. Also inhibits Ih in central neurons and inhibits synaptic transmission.




¡¡ AST AST-218-10mg ZM 241385 ¡Ú4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol¡Û¡ÚPotent, selective A2A Antagonist¡Û 10mg ¾È²ñ RT 139180-30-6
¡¡
¡¡
¡¡
Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 ¦ÌM at human cloned A2A, A2B, A1 and A3 receptors respectively. O




¡¡ AST AST-218-50mg ZM 241385 ¡Ú4-(2-[7-Amino-2-(2-furyl)[1,2,4]triazolo[2,3-a][1,3,5]triazin-5-ylamino]ethyl)phenol¡Û¡ÚPotent, selective A2A Antagonist¡Û 50mg ¾È²ñ RT 139180-30-6
¡¡
¡¡
¡¡
Potent A2 adenosine receptor antagonist, with approx 50-fold selectivity for A2A receptors. Ki values are <1 nM, 50 nM, 255 nM and >10 ¦ÌM at human cloned A2A, A2B, A1 and A3 receptors respectively. O




¡¡ AST AST-076-10mg Zopiclone ¡Ú4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester¡Û 10mg ¾È²ñ +4¡î 43200-80-2
¡¡
¡¡
¡¡
Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.




¡¡ AST AST-076-50mg Zopiclone ¡Ú4-Methyl-1-piperazinecarboxylic Acid, 6-(5-Chloro-2-pyridinyl)-6,7-dihydro-7-oxo-5H-pyrrolo[3,4-b]pyrazin-5-yl Ester¡Û 50mg ¾È²ñ +4¡î 43200-80-2
¡¡
¡¡
¡¡
Benzodiazepine receptor agonist. Non-benzodiazepine hypnotic.





¥Û¡¼¥à

µ­ºÜ¤Î¤Ê¤¤¥á¡¼¥«¡¼¡¢¾¦ÉʤˤĤ¤¤Æ¤â¤ªµ¤·Ú¤Ë¤ªÌ䤤¹ç¤ï¤»²¼¤µ¤¤¡£

Åö¥µ¥¤¥ÈµÚ¤ÓÊÀ¼Òȯ¹Ô¤Î¥«¥¿¥í¥°µ­ºÜ¤ÎÆâÍÆ¤Ï¡¢Í½¹ð¤Ê¤¯Êѹ¹¤µ¤ì¤ë¤³¤È¤¬¤´¤¶¤¤¤Þ¤¹¡£Í½¤á¤´Î»¾µ¤¯¤À¤µ¤¤¡£

¤³¤Î¥Û¡¼¥à¥Ú¡¼¥¸¤Ë´Ø¤¹¤ë¤ªÌä¹ç¤»¤Ï
¥Ð¥¤¥ª¥ê¥ó¥¯¥¹³ô¼°²ñ¼Ò
Biolinks K.K.
E¥á¡¼¥ë
mail
½»½ê¡§¢©140-0013¡¡ÅìµþÅÔÉÊÀî¶èÆîÂç°æ
£²¡Ý£±£²¡Ý£µ¡Ý£·£±£°
£Ô£Å£Ì¡§03-5767-6821
£Æ£Á£Ø¡§03-5767-6822